KEGG   Rhodothermus marinus DSM 4252: Rmar_2513Help
Entry
Rmar_2513         CDS       T01119                                 

Definition
(GenBank) Exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmr03016]
    Rmar_2513
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Rmar_2513
Transfer RNA biogenesis [BR:rmr03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Rmar_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1 DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACY49389
UniProt: D0MFD3
LinkDB All DBs
Position
2923737..2925716
Genome map
AA seq 659 aa AA seqDB search
MKPGTLVEYLEDDRPQFALVLASRDGSVQALTPTGRRIRLPVRRIAIRHERTATAEALAE
VVQALEAQIDALQAEIDLALLWETAREEGEAFDLEALARLYFGEAGPLEQAALLRALLSD
TLYFGRRGLTFVPRTPEQVEALQTAERRRREREAERRALRAQLEQLLDAEADELSEAPAA
LLDALEAYLRQKQRSETTEVLAEVARDRGMTTREAALEILLRTGRIDASIDTFALLAGIE
PTFPSEVLAAAEALVPFEPTGDRTDFTHLPAFHIDDASTREIDDAFTVEPLAEGGWRIGI
HLADVPHFVAPDDVLDREARRRGLTRYLPTGSIPMLPERLSHDLASLRPDAIRPTLSVVV
TVDASEQIRDVQLVRGQIRVAHGFTYETADAVLSGETPHELAEALQVLARLSQTLTEARL
ARGALLIRRPELKVQVDGDTITLKVIDPDTPARRMVSEWMILANAEAARWAAENELPMIY
RVQDPPDDPELQGRKLDYDPVLLASRLRGLRRTRFSTHPQPHAGLGLEAYVQITSPIRRY
ADLALQRQIVAALADAPLPYDTTRLFEVLATAEAAEREARALEQQATRYWALVWLERHAA
QTFEAIVVARRPAGYLVELQPYGLRGLLATADALAPGDRVAVRPEAIDPRRGRLRLQRA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgggtacgcttgtcgaatatcttgaggatgaccggccgcaatttgcgctggtg
ctggcgtcgcgcgacggctccgtgcaggcgctgacgcccaccggacgccgcatccggctg
ccggttcgtcgcattgccattcgccacgaacgcaccgccacggccgaggcgctggccgag
gtggtacaggcgctggaagctcagatcgacgcgctgcaggcggagatcgacctggccctg
ctctgggagaccgcccgcgaagaaggcgaggcgttcgacctggaagccctggcccggctc
tacttcggcgaggccgggccgctggaacaggcggcgctgctgcgggcgctcttaagcgat
accctgtacttcggccgccggggcctgaccttcgttccgcgcacacccgagcaggtggaa
gccctgcagacggcggagcgccgccgccgggaacgtgaggccgaacgccgggcgctgcgc
gcacagctcgaacaactgctcgacgccgaggccgacgagctgtccgaggcgccggccgca
ttgctggacgcgctcgaagcctacctgcgccagaagcagcgctccgaaaccaccgaggtg
ctggccgaggtagcccgtgaccggggcatgaccacccgcgaggctgccctggagatcctg
ctgcgcacgggtcgcatcgacgcctccatcgatacgttcgcgctgctggccggcatcgaa
ccgaccttcccgtccgaagtgctggccgccgccgaagcgctcgtgcccttcgaaccgacc
ggagaccgcaccgactttacacacctgcccgcctttcacatcgacgacgcttccacgcgc
gagatcgacgatgccttcaccgtcgaaccactggccgagggcggctggcgcatcgggatt
catctggccgacgtgccccatttcgtcgcgccggacgacgtgctcgaccgggaagcccgg
cgccggggcctgacccgctacctgcccaccggctccattcccatgctgcccgagcgcctg
agccacgacctggccagccttcgtcccgacgcaatccgccccacgctgagcgtggtggtg
accgtggacgcctcggagcagatccgggacgtgcagctcgtgcgtggacagatccgcgtg
gcgcatgggttcacctacgaaacggccgatgcagtgctgtccggcgaaacgccgcacgag
ctggccgaggcgctgcaggtgctggcccgcctgagccagacgctgaccgaagcccggctg
gcgcgcggcgcgctgctgatccggcgacccgagctcaaagtgcaggtggacggcgacacg
atcacgctcaaggtgatcgatcccgacacacccgcccgacgcatggtcagcgaatggatg
atcctggccaatgccgaggcggcccgctgggcggccgaaaacgagctgcccatgatctac
cgcgtgcaggatccgcccgacgatcccgagttgcagggacgcaagctggactacgacccc
gtgctgctggccagccggttacgcgggctgcgccgcacacgcttttccacgcacccccag
cctcatgccggactcggtctggaggcctacgtgcagatcacctcgccgatccggcgctat
gccgacctggccctgcagcgtcagatcgtggccgcgctggccgacgcgccgctcccgtac
gacaccacccggctgttcgaagtgctggccaccgccgaggcggcagaacgcgaggcccgg
gcgctggagcagcaggccacccgctactgggcgctggtctggctcgaacgccatgcggcg
cagaccttcgaggcgatcgtcgtggcccgccgcccggccggctacctcgtcgagctgcag
ccctacggcctgcgtggcctgctggccacggccgatgcgctggcccccggcgaccgcgtc
gccgtacgtcccgaagcgatcgatccccgccgcggccgcctccgcctgcagcgggcctga

DBGET integrated database retrieval system