KEGG   Rhodothermus marinus DSM 4252: Rmar_2517Help
Entry
Rmar_2517         CDS       T01119                                 

Definition
(GenBank) tRNA (guanine-N(7)-)-methyltransferase
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
rmr  Rhodothermus marinus DSM 4252
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmr03016]
    Rmar_2517
Enzymes [BR:rmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     Rmar_2517
Transfer RNA biogenesis [BR:rmr03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    Rmar_2517
 Prokaryotic type
    Rmar_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ACY49393
UniProt: D0MFD7
LinkDB All DBs
Position
complement(2926776..2927720)
Genome map
AA seq 314 aa AA seqDB search
MILRTGQFTFPTPPAQLFGREAPLMLEIGFGDGGFLTDWAARHPDWNVLGVEISPGSMRR
AFGRVRRAGLTNVRLYLGQARFLVRNVLPLRSLSLVYVNFPDPWPKKRHQERRLLQAPFF
ELLSTRLADGGALRLTTDDAPYFSFALEEAEKTGLYRIEVTEPPPETLQTKYARKWQAQQ
KPIYHAVFTKQAEASDPFPPSIERYDVMHHALLEGTLPALERFEKLVHAFRGGHVIVLEA
YRTLDGTGLLFLVRIEEEDLTQEVLVEARPKDGKVLVRVLPFGLPLSTRGTREAIRCLTE
WLETQGMRLAEAFF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatattgcgcaccggacagttcaccttcccgacgccgcccgcgcagctcttcggccgc
gaggcgccgctgatgctggagatcggcttcggcgacggcggctttctgacggactgggcg
gcgcgtcacccggactggaacgtgctgggcgtggagatttcgccgggctcgatgcggcgg
gcgttcgggcgggtgcgccgggccggcctgaccaacgtgcggctctatctgggccaggcc
cgctttctggtgcgtaacgtgttgccgctgcgcagcctgtcgctggtgtacgtgaacttc
ccggatccctggcccaaaaagcgccaccaggagcggcggctgttgcaggcgccgtttttc
gagctactttccacccgactggccgacggcggggcgcttcggctgaccaccgacgacgcg
ccgtatttttcttttgcgctggaagaggccgaaaagaccgggctgtatcggatcgaagtg
accgagccgccgccggagacgctccagaccaagtacgcgcgtaagtggcaggcccagcag
aaacccatttaccacgccgtctttacgaagcaggccgaggcttccgatccgtttcctccg
tccatcgaacgctacgacgtcatgcaccacgcactgctggaagggacgctccccgcgctg
gaacgcttcgagaaactggtccacgccttccgaggcggtcacgtgatcgtgctcgaagcc
taccggacgctcgacggcaccgggctgctgtttctggtgcggattgaggaagaggacctg
acgcaggaggtgctggtcgaagcgcgtccgaaggacggaaaggtgctcgtgcgcgtgctt
ccgttcggtcttccgctctcgacgcggggcacgcgcgaggcgatccggtgcctgaccgaa
tggctggaaacgcagggcatgcgcctggctgaagcgtttttctga

DBGET integrated database retrieval system