KEGG   Rhodothermus marinus DSM 4252: Rmar_2584Help
Entry
Rmar_2584         CDS       T01119                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00010  Glycolysis / Gluconeogenesis
rmr00020  Citrate cycle (TCA cycle)
rmr00620  Pyruvate metabolism
rmr00640  Propanoate metabolism
rmr00650  Butanoate metabolism
rmr00680  Methane metabolism
rmr01100  Metabolic pathways
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
Module
rmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_2584
   00020 Citrate cycle (TCA cycle)
    Rmar_2584
   00620 Pyruvate metabolism
    Rmar_2584
   00640 Propanoate metabolism
    Rmar_2584
   00650 Butanoate metabolism
    Rmar_2584
  Energy metabolism
   00680 Methane metabolism
    Rmar_2584
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rmar_2584
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rmar_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACY49457
UniProt: D0MFW8
LinkDB All DBs
Position
3003479..3004678
Genome map
AA seq 399 aa AA seqDB search
MTLVVTPRLEAAQLLTGAQAVAHAMRQIEPDVVPVYPITPQTPIIEEFAQMVADGRCDTE
IVNVESEHSAMSAAVGASVAGARVMTATASQGLALMIEVLYIAASMRCPIVMPLGNRALS
GPINIHCDHSDAMLARDSGAVQIFTENGQEAYDYTLMAVRLAEDQRVLLPVIVNLDGFTL
THSAEAVELLPDEVARAFVGHYRPLYPLLDTVRPTTQGPFDMPDFYYEHKRQQDEAMRGV
LEVFPEVQRAYAEATGRNYRGYYEAYRLDDADFAVVVLGSTAGTAKVVVDTLRDEGQRVG
LLKLWLFRPFPHAAVAEALRGKQAVAVMDRALSFGSWGPLFTEIAAALYGLPEAERPRLH
NFTYGLGGRDVTPDQIAEALTRIQDPHTPAVMHYLGVRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtggtcactccccggctcgaagccgcccagttactgacgggcgcgcaggct
gtggcgcacgccatgcgccagatcgagcccgacgtcgtgccggtctatccgatcacgccg
cagacgccgatcatcgaagagtttgcgcagatggtggccgacggccgctgcgacaccgaa
atcgtcaacgtcgagtcggagcactcggccatgagcgcggccgtgggcgcttcggtggcc
ggcgcgcgcgtgatgacggccacggcctcgcagggcctggcgctgatgatcgaggtgctc
tacatcgcggcctccatgcgctgcccgatcgtgatgccgctgggcaaccgggcgctgagc
gggccgatcaacatccactgcgaccactccgacgccatgctggcccgcgattcaggcgcc
gtccagatcttcaccgaaaacggccaggaagcctacgactacacgctgatggccgtgcgc
ctggccgaagaccagcgggtgctgttgcccgtgatcgtcaatctggacggcttcacgctc
acgcattcggccgaggccgtcgagctgctgcccgacgaggtggcccgggcgttcgtgggc
cactatcggccgctctatccgctgctggacacggtgcgccccaccacgcagggcccgttc
gacatgcccgacttctactacgagcacaagcggcaacaggacgaggccatgcgaggcgtg
ctggaggtcttccccgaggtgcagcgcgcctacgccgaggccaccggccgcaactaccgg
ggttactacgaagcctaccggctcgacgatgcggactttgccgtggtcgtgctgggatcg
acggccggcacggccaaagtcgtcgtcgatacgcttcgggacgaagggcagcgggtgggt
ctgctcaagctgtggctcttccgacccttcccgcatgccgccgtggccgaagcgctgcgc
ggcaagcaggccgtggccgtgatggaccgggcgctgtcgttcggaagctgggggccgctc
ttcaccgaaattgccgcggccctgtacggcctgcccgaagccgagcgaccgcgcctgcac
aacttcacctatggtctgggagggcgcgacgttacgcccgaccagatcgccgaagcgctg
acccgcattcaggatccgcacacgcctgccgtcatgcactatctgggcgtgcgcgcctaa

DBGET integrated database retrieval system