KEGG   Rothia mucilaginosa: RMDY18_00820
Entry
RMDY18_00820      CDS       T01144                                 

Definition
(GenBank) fructose/tagatose bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00030  Pentose phosphate pathway
rmu00051  Fructose and mannose metabolism
rmu00680  Methane metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01200  Carbon metabolism
rmu01230  Biosynthesis of amino acids
Module
rmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_00820
   00030 Pentose phosphate pathway
    RMDY18_00820
   00051 Fructose and mannose metabolism
    RMDY18_00820
  09102 Energy metabolism
   00680 Methane metabolism
    RMDY18_00820
Enzymes [BR:rmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     RMDY18_00820
SSDB
Motif
Pfam: F_bP_aldolase PSII_BNR
Other DBs
NCBI-ProteinID: BAI63914
UniProt: D2NQI8
LinkDB
Position
86116..87141
AA seq 341 aa
MAIATPEVYAEMLQTAKEKGFAYPAVNVTSSQTLNAAIRGFAEAGSDGIIQASTGGAAYW
SGASKKDMVVGSLAFAAYAREVAKQYDVNIALHTDHCPKDKLEGFVLPLLAESEKAVARG
EDPIFNSHMWDGSAIDLDENLKIAAELIERTSKAKLVLEVEIGAVGGEEDGVEGAIDDSL
YTTVADAIKTVEAIGLGEKGTYMAALTFGNVHGVYKPGNVHLRPELLKEIQTEVGAKYGK
GDKPFYLVFHGGSGSTEQEIADAVSYGVIKMNIDTDTQYAFTRPVAGHMFSNYDGVLKVD
GEVGNKKTYDPRVWGAAAEAGMAARVVEACQQLGSVGTSIK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctattgcaacccccgaagtttacgcagaaatgctgcagaccgcgaaggaaaagggc
ttcgcgtaccccgcagtgaacgtgacctcctcccagaccctgaatgctgcaatccgcggc
ttcgcagaggctggctcggacggcatcatccaggcatccaccggtggtgcagcatactgg
tccggcgcttccaagaaggacatggtcgttggctccctggccttcgcagcatacgcacgc
gaagttgctaagcagtacgacgtgaacattgcactgcacaccgaccactgccccaaggac
aagctggaaggcttcgtcctgcccctgctggcagagtccgagaaggctgttgctcgcggt
gaagaccccatcttcaactcccacatgtgggacggctccgcaatcgacctggacgagaac
ctgaagattgctgctgagctgatcgagcgtacctccaaggcaaagctcgttctcgaggtt
gagattggtgccgttggtggcgaggaagacggcgttgaaggcgctatcgacgactccctg
tacaccaccgttgcagacgcaatcaagaccgttgaggcaatcggcctgggcgagaagggc
acctacatggctgctctgaccttcggtaacgttcacggcgtgtacaagcccggtaacgtt
cacctgcgccccgagctgctcaaggaaatccagaccgaggtcggcgctaagtacggcaag
ggcgacaagcccttctacctggtcttccacggtggctccggctccaccgagcaggagatt
gcagacgcagtgtcctacggtgttatcaagatgaacatcgacaccgacacccagtacgca
ttcacccgccccgttgctggccacatgttcagcaactacgacggtgtgctgaaggttgac
ggcgaggtcggcaacaagaagacctacgacccccgcgtttggggtgcagctgcagaggca
ggcatggccgcacgcgtggtcgaggcttgccagcagctcggttccgtcggtacctccatc
aagtaa

DBGET integrated database retrieval system