KEGG   Rothia mucilaginosa: RMDY18_05010
Entry
RMDY18_05010      CDS       T01144                                 

Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00230  Purine metabolism
rmu00730  Thiamine metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01240  Biosynthesis of cofactors
Module
rmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RMDY18_05010
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RMDY18_05010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmu04147]
    RMDY18_05010
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     RMDY18_05010
Exosome [BR:rmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMDY18_05010
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Cytidylate_kin SRP54 Thymidylate_kin AAA Zeta_toxin NTPase_1 Cytidylate_kin2 RuvB_N ABC_tran
Other DBs
NCBI-ProteinID: BAI64333
UniProt: D2NRQ7
LinkDB
Position
520966..521529
AA seq 187 aa
MNRLLIVGPPGAGKGTQAVKIAEALKIPAISTGDIFRKNIKEETELGKEAKSYIDSGNLV
PDSVTNNMVRARLEESDVVNGFLLDGYPRNTSQVHELDSILEAKGEKIDRVLLLVADNDE
LVERLLNRAAEQGRTDDNEEVIRHRLKVYEEETAPLIAIYRERGIVKEVNGLGEIAEVTE
RILDALK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaaccgtctgctcatcgtcggccctcccggtgcaggtaagggcacccaggccgtcaag
atcgctgaagcgctgaagattcccgcgatttccaccggtgatatcttccgtaagaacatc
aaggaagagaccgagctgggcaaggaagcgaagtcgtacatcgactccggcaacctggtt
cccgactctgtcaccaacaacatggtgcgcgcacgtctggaggaaagcgacgtcgtcaac
ggcttcctgctcgacggctacccccgcaacacctcccaggtgcacgagctagactccatc
ctcgaagccaagggtgagaagatcgatcgagttctcctgctggttgcagacaacgacgaa
ctcgttgagcgtctgctcaaccgcgcagcagagcagggtcgtaccgatgacaacgaagag
gtcattcgtcaccgcctgaaggtctacgaagaagagaccgcaccgctgatcgcaatctac
cgcgaacgcggcatcgtcaaggaagttaacggcctcggcgagattgctgaagtcaccgag
cgcatcctcgacgctctgaagtaa

DBGET integrated database retrieval system