KEGG   Rothia mucilaginosa: RMDY18_05160
Entry
RMDY18_05160      CDS       T01144                                 

Definition
(GenBank) panthothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00770  Pantothenate and CoA biosynthesis
rmu01100  Metabolic pathways
rmu01240  Biosynthesis of cofactors
Module
rmu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RMDY18_05160
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     RMDY18_05160
SSDB
Motif
Pfam: PRK AAA_18 CoaE
Other DBs
NCBI-ProteinID: BAI64348
UniProt: D2NRS2
LinkDB
Position
complement(534721..535677)
AA seq 318 aa
MSTAPYFSSDDRFMHLDRSRWSHLADEIAVPLSAEEIESLRGLGETVDLEEVQRIYLPVS
RLLNLYVTAASSLNHMTNDFLHVSQRRVPFIIGVAGSVAVGKSTTARILQALLSRWPSTP
KVQLVTTDGFLYPNAELQRRGIMHRKGFPESYDRRALLNFVSQVKSGAERVVAPKYSHLY
YDIMPDEHIEVTAPDVLILEGLNVLAPSQAEGPETSDLTLSDFFDFSIYVDARTEDIERW
YVNRFLTLRSSAFANPESYFKRYAELSDEQAVEVATGIWKSVNEPNLLQNVLPTRARAHL
ILQKGPEHTVEQVLLRKN
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagcaccgcaccgtatttttctagcgatgaccgcttcatgcatctagaccgttcccgt
tggtcgcacctagccgatgagattgctgttcccctcagcgctgaggaaattgagtctctt
cgaggcctgggtgaaactgtcgaccttgaagaggtgcagcgtatttatctgccggtttct
cgccttcttaatctgtatgtaactgccgcatcctcgctgaaccatatgacgaatgatttt
ctgcatgtgtctcagcgtcgcgtcccgttcattattggtgtggcgggttctgttgctgtg
ggtaagtcgacgacggctcgtattttgcaggctcttttgagtcgctggccttcgactccg
aaggttcagttggtgactacggatggtttcttgtacccgaatgcggagcttcagcgtcgc
ggcattatgcaccgtaagggtttcccggagtcttatgatcgccgtgctctgttgaatttt
gtgtcgcaggtgaagtccggtgctgagcgtgtggtggcgccgaagtattcgcacctgtat
tacgacatcatgccggatgagcatattgaagtcaccgcaccggatgtgctgattcttgaa
ggcttgaatgttttggcgccttctcaggctgaggggccggagacttctgatctgacgctg
agtgatttctttgatttctctatttatgtggatgcccgcactgaggatattgagcgctgg
tatgtgaatcgtttcttgactctgcgttcttcggcttttgcgaatccggagtcgtatttc
aagcgttatgcggagctgagcgatgagcaggcggttgaggttgcgaccggcatttggaag
agcgtgaatgagccgaatctgttgcagaatgttttgccgactcgtgctcgtgcgcatttg
attctgcagaagggccccgagcataccgtggagcaggttcttctgcgtaagaactag

DBGET integrated database retrieval system