KEGG   Rothia mucilaginosa: RMDY18_05620Help
Entry
RMDY18_05620      CDS       T01144                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00220  Arginine biosynthesis
rmu00250  Alanine, aspartate and glutamate metabolism
rmu00290  Valine, leucine and isoleucine biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01130  Biosynthesis of antibiotics
rmu01210  2-Oxocarboxylic acid metabolism
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RMDY18_05620
   00290 Valine, leucine and isoleucine biosynthesis
    RMDY18_05620
   00220 Arginine biosynthesis
    RMDY18_05620
Enzymes [BR:rmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RMDY18_05620
    2.6.1.66  valine---pyruvate transaminase
     RMDY18_05620
Amino acid related enzymes [BR:rmu01007]
 Aminotransferase (transaminase)
  Class I
   RMDY18_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAI64394
UniProt: D2NRW8
LinkDB All DBs
Position
582833..584056
Genome map
AA seq 407 aa AA seqDB search
MTKYRQSSKLSNVLYDIRGPILDEANRMEAMGHRILKLNIGNPAPFGFEAPDAIMMDIIR
HLPETQGYSDSRGLYSARTAIVQHYQNRGIMNLDTDAVYLGNGVSELIPMTLQALCETGD
EILVPMPDYPLWTASTALVGGKPVHYLCDEENNWYPDIEDIKSKITERTKGIVVINPNNP
TGAVYPRAILQQIVDVAREHGLVVFSDEIYEKITYDGAEAINMASLTGDDVLCLTFSGLS
KAYRVCGYRAGWVAITGPKKDASSYLEGIHLLASMRLCSNVPAQHAIQTALGGYQSINEL
IVPGGRLYEQRTLAHKMLNEIDGISCTSADGALYLFPKIDVERFDITDDEQFALDLLKSQ
KILFSHGRAFNWKDPDHFRLVFLPDTQTLTSALERLGNFMADYKQKH
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtaccgtcagtcctcaaagttgagtaacgtcctgtacgacatccgcggcccc
attctggacgaggccaatcgcatggaagcgatgggccaccgcatcctcaaactgaacatc
ggtaaccccgcgcccttcggctttgaagcgcccgacgcgatcatgatggacatcattcgc
cacctgcccgaaacccagggttactccgactcccgcggcctctactcggcacgtaccgcc
attgtgcagcactaccagaaccgcggcatcatgaacctcgacaccgacgccgtctacctc
ggcaacggcgtgtctgagctgatcccgatgaccctgcaggcactgtgcgagaccggcgac
gaaatcctggttcccatgcctgactacccgctgtggaccgcatccaccgcgctggttggc
ggcaagcccgtgcactacctctgcgatgaggaaaacaactggtacccggatattgaagac
atcaagtcgaagattaccgagcgcaccaagggcatcgtggttattaacccgaataacccc
accggcgctgtgtacccgcgtgcaatcctgcagcagatcgtggacgtggcacgcgaacac
ggtctggttgtgttctccgacgaaatctacgaaaagatcacctacgacggtgctgaggcc
atcaacatggcttctctaaccggcgacgacgtgctctgcctgaccttctccggtctgtcc
aaggcataccgcgtctgcggttaccgtgcgggctgggtcgctatcaccggcccgaagaag
gacgcctcaagctaccttgagggtattcacctgctcgcctccatgcgcctgtgctccaac
gttccggcacagcacgcaatccagaccgcgctgggcggctaccagtccattaacgagctg
attgtccccggcggccgcctctacgagcagcgcaccctggcgcacaagatgctcaacgag
attgacggcatcagctgcaccagtgcggacggcgcactgtacctgttcccgaagattgat
gttgagcgcttcgacattaccgacgacgagcagttcgccctggacctgctcaagagccag
aagattctcttcagccacggccgcgcgttcaactggaaggacccggaccacttccgcctg
gtgttcctgcccgatacgcagaccctcaccagcgccctggagcgcctgggtaacttcatg
gctgactacaagcagaagcactag

DBGET integrated database retrieval system