KEGG   Rothia mucilaginosa: RMDY18_06050
Entry
RMDY18_06050      CDS       T01144                                 

Definition
(GenBank) tetrahydrodipicolinate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00300  Lysine biosynthesis
rmu01100  Metabolic pathways
rmu01120  Microbial metabolism in diverse environments
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    RMDY18_06050
Enzymes [BR:rmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     RMDY18_06050
SSDB
Motif
Pfam: Hexapep_2 THDPS_M THDPS_N Hexapep
Other DBs
NCBI-ProteinID: BAI64437
UniProt: D2NS11
LinkDB
Position
complement(625984..626949)
AA seq 321 aa
MGGMSENTPRYASGVALVNVVISGEHAGTVLDAWFPAPSLTQTPDLSIADELEDLAVEHP
ARNARTEVRSASINLDEAPEDAVDAYLRLHLLSHTLVRPNELNLDGLFGTLANVAWTNHG
PVLAAEFQKLAIGLRKLGHLSVSHIDKFPRLVDYVVPAGVRIGDGDRLRLGAHLASGTTV
MHEGFVNFNAGTLGTSMVEGRISQGVVVGDGSDVGGGASTMGTLSGGGKKRVSIGERSLL
GAESGIGIALGDDCVVEAGLYVTAGSRVSVLLPGQEARVVKAAELSGVSNLLFRRNSLSG
AIEVLPRAKNTVELNEALHLN
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggaggcatgtctgaaaacactccccgttacgcctccggcgttgcactggtcaatgtt
gttatctctggcgagcacgccggcaccgtcctggatgcttggttccccgccccctccctc
acccagacccccgacctatccatcgcggacgagctggaggacctggccgttgagcatccg
gcgcgcaacgcccgtaccgaggtgcgtagcgcctccatcaacctggatgaggcacccgaa
gacgcggtggacgcatacctacgtctgcacctgctctcccacactctggttcgccccaac
gagctgaacctggacggcctgttcggtaccctggcgaatgttgcgtggactaaccacggc
ccggtgcttgccgccgaattccagaagctggcgattggtctgcgcaagctgggccacctg
agcgtgagccacattgataagttcccgcgcctggtggattacgtggttcccgccggcgtg
cgtattggtgacggtgatcgcctgcgcctgggtgcgcacttggcgtccggcacgaccgtg
atgcacgagggcttcgtgaacttcaacgccggtaccctgggcacctccatggttgagggc
cgtatttctcagggcgttgtggtgggcgacggctcggatgtgggtggcggcgcctccacg
atgggtaccctctcgggcggcggtaagaagcgcgtgtccattggtgagcgttccctgctg
ggtgcggagtccggcatcggtattgccctgggcgatgactgcgtggttgaggctggcctg
tacgtgaccgccggttcacgagtgagcgttctgctgcccggtcaggaggcgcgcgtggtg
aaggctgcggagctgtccggtgtgtcgaacctgctgttccgccgtaattcgctgagcggc
gcgattgaggttctgccgcgtgcgaagaacaccgtggaactgaacgaggcactgcacctg
aactag

DBGET integrated database retrieval system