KEGG   Rothia mucilaginosa: RMDY18_08190
Entry
RMDY18_08190      CDS       T01144                                 

Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00770  Pantothenate and CoA biosynthesis
rmu01100  Metabolic pathways
rmu01240  Biosynthesis of cofactors
Module
rmu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RMDY18_08190
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     RMDY18_08190
SSDB
Motif
Pfam: CTP_transf_like FAD_syn Citrate_ly_lig
Other DBs
NCBI-ProteinID: BAI64651
UniProt: D2NSM5
LinkDB
Position
885948..886424
AA seq 158 aa
MIALCPGSFDPVHHGHLEIIVRAAQLFDEVIVGVAHNSSKKYRFSLEERVQLVRESLQEL
GIEGVSVEPIPPGVLLAEYAAERGAKVLVKGLRSATDYSYEAPMASMNRHLAQVETVFLA
GEDRYGAVSSTIIREVASLGGDVTPFVPEAVARALKSA
NT seq 477 nt   +upstreamnt  +downstreamnt
atgattgccctctgccccggatcttttgaccccgtgcaccacggccacctggaaatcatt
gtccgcgccgctcagctctttgacgaggtgattgtgggcgtggcacacaatagctccaag
aagtaccgtttctccctggaggagcgcgtgcagctggtgcgtgagtctctgcaggagctc
ggcattgagggtgtgagcgtggaaccgattccgccgggcgtgctgcttgccgagtacgcg
gcggagcgtggtgcgaaggtgctggtgaagggtctgcgttcggcgacggactacagttat
gaggctccgatggcgagcatgaaccgccacctggcgcaggttgagacggtgttcttggcg
ggtgaggatcgctacggtgcggtgtcgtccacgattattcgtgaggtggcgtcgctgggt
ggtgacgtgactcccttcgtgccggaggcggtcgcccgcgccctgaagagtgcctag

DBGET integrated database retrieval system