KEGG   Rothia mucilaginosa: RMDY18_08870
Entry
RMDY18_08870      CDS       T01144                                 

Definition
(GenBank) NAD(P)H-nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00910  Nitrogen metabolism
rmu01100  Metabolic pathways
rmu01120  Microbial metabolism in diverse environments
Module
rmu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RMDY18_08870
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     RMDY18_08870
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox NIR_SIR_ferr Rubredoxin_C AlaDh_PNT_C NAD_binding_8
Other DBs
NCBI-ProteinID: BAI64719
UniProt: D2NSU3
LinkDB
Position
962520..965189
AA seq 889 aa
MSHTPRNILVVGAGPAAWRFVRAYHEGAEAAGRAADTITVLNDEPYIPYDRVAIEKIFKD
TEKDLTLGDPELWNAENINLVNNCHAEKLDRTRRVVTDTEGNEYPYDVLVFATGSRAVRI
PILNSDAAHVFRTIDDVKNMVSEVNRLQDTLGRAPRGIVVGGGLLGLEAAEGLKDLGAEP
TILDVAPWLLSVEVDQGGGYAVNAQIKATGIEIETGVYISGINKDADGNVVSVSIADSPS
EDAEIRTLPADMVVFGAGIRPNDELARDADLALGERGGILVNDACHSSDEHIWAIGEVAC
VLGRTWGLVAPANAMADAVAANLLNDNEEAQVEEFDIATKLKFSGVQVAGFGDRRGTTEG
CLEVLFADPARGMYQKIVTSGDAKTLLGGVFVGDTAPFDSLKPLLGRELPAEPNVYLTAA
GGGDGIPDTELPDDAILCSCNNISFGAVREAIVDGNHDVASLKSCTTAGTQCGSCVPMLQ
KTLEQQMKKMGLTVSKALCEHFDFSRAELAEAVRLTNLDDFDSVLARFGRGGDGCAICKP
TVASILSSFRNSYVLDAGRGGIQETNDRALANMQKNGTYSVVPRIPAGEIPAKKLGVIAE
VAEEFGLYVKITGAQRIGMFGARLEQLPYIWERLVDAGFESGQAYGKSLRNVKSCMGSTW
CRFGVQDSTGMAIQLENRYRGLRSPHKFKFGVSGCNRECAEAQGKDVGLIATTNGWNLYL
GGNGGANPAHGRLFVKDASSEDIIRYIDRYLMYYIRTADKLQRTARWLEDLDEEHGDGLA
HLQSVLIEDSLGVCEDLERDMQRHVDSYEDEWAATLRDERRLRRFRAFINEPNGSDEGSH
LYVLEREQIRPATPEEIAAAEAGESDTVLLTGTKIPVGKPSDLNPVPAA
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgtcgcacaccccccgcaacattctcgttgtcggcgcaggccccgctgcgtggcgtttt
gtacgcgcgtaccacgaaggcgctgaagctgccggtcgcgcagcggacaccatcaccgtc
ctcaacgatgagccctacatcccctacgaccgcgttgctatcgagaagattttcaaggac
accgagaaggacctgaccctcggtgaccccgaactctggaatgcagagaacatcaacctg
gtcaacaactgccacgcagagaagcttgaccgcacccgccgcgtcgtcaccgacaccgag
ggcaacgagtacccctacgacgtgctggtcttcgcgaccggttcccgcgcggttcgtatc
cccattcttaactcggacgccgcacacgtcttccgcaccattgacgacgtgaagaacatg
gtctccgaggttaaccgcctgcaggacaccctcggccgcgcaccccgcggtattgtcgtc
ggtggcggtctgctcggcctcgaagcagctgagggtctgaaggacctgggcgcagagccc
accatcctggatgtggctccctggctgctttccgttgaggttgaccagggtggcggttac
gccgtgaacgcccagattaaggcaaccggcattgagattgagaccggcgtgtacatctcc
ggcatcaacaaggatgctgacggcaacgtcgtctccgtctccatcgcagattctccctct
gaggatgcagaaatccgcaccctgcccgccgacatggtggtcttcggtgccggtattcgc
cccaacgacgagctggcacgcgacgccgacctggcactgggcgagcgcggcggtattctc
gtcaacgacgcatgccactcctccgacgagcacatttgggctatcggtgaggtcgcctgc
gtgctgggccgcacctggggtctggtcgcaccggctaacgctatggctgatgctgtggca
gctaacctgctcaacgacaacgaagaagctcaggttgaagagttcgacattgcaaccaag
ctgaagttctccggcgttcaggttgctggcttcggtgaccgccgcggcaccaccgagggt
tgcctcgaggttctgttcgcagatcccgcccgcggtatgtaccagaagattgtgaccagt
ggcgacgcaaagaccctgctgggtggcgtgttcgtcggtgacaccgctcccttcgactcc
cttaagcccctgctcggccgcgaactgcccgctgaaccgaacgtttacctgaccgcagct
ggcggtggcgacggcatccccgacaccgaactgcccgacgacgcaatcctgtgttcctgc
aacaacatcagcttcggtgctgtccgcgaggctatcgttgacggcaaccacgatgttgca
tccctgaagtcctgcaccaccgcgggtacccagtgtggttcctgtgttccgatgctgcag
aagactctggaacagcagatgaagaagatgggtctgaccgtctccaaggcactgtgtgag
cacttcgacttctcccgtgctgagctggctgaggctgtgcgcctgaccaacctggacgac
tttgactccgttctggcacgcttcggccgcggtggcgacggctgtgcaatctgtaagccg
accgttgcgtcgattctctcctccttccgcaactcctacgtcctggacgcaggccgcggt
ggtattcaggagaccaacgaccgcgcactggcgaacatgcagaagaacggtacctactcc
gtcgttccgcgtattcctgcaggtgagattcccgctaagaagctgggcgtcatcgcagag
gtcgctgaagagttcggtctgtatgtgaagattaccggtgcgcagcgtatcggtatgttc
ggtgctcgcctggagcagctgccctacatttgggagcgcctggtggatgccggtttcgaa
tccggtcaggcatacggtaagtccctgcgtaacgtgaagtcctgcatgggttcgacctgg
tgccgcttcggtgttcaggactctaccggcatggcaatccagctggagaaccgttaccgc
ggtctgcgttccccgcacaagttcaagttcggcgtttccggttgtaaccgtgaatgtgct
gaggcacagggcaaggacgttggtctgattgcaaccaccaacggctggaacctgtacctg
ggcggtaacggtggtgcaaaccccgctcacggtcgcctcttcgtcaaggacgcctccagc
gaggacatcatccgctacattgaccgctacctgatgtactacatccgtaccgcagacaag
ctgcagcgtaccgctcgctggctcgaggatctggatgaggagcacggcgacggtctggca
cacctgcagtccgtcctcattgaggactccctgggcgtgtgcgaggacctggagcgcgac
atgcagcgtcacgttgactcctacgaggacgagtgggcagcaaccctgcgcgacgagcgc
cgtctgcgccgcttccgcgccttcatcaacgagcccaacggcagcgacgagggttcgcac
ctgtacgtgctggagcgcgagcagattcgccccgcaacccccgaggaaattgcggcggca
gaagctggcgagtccgacaccgtcctgctgaccggtaccaagattcccgtgggtaagccc
agtgacctcaacccggtcccggcagcatag

DBGET integrated database retrieval system