KEGG   Rothia mucilaginosa: RMDY18_10460Help
Entry
RMDY18_10460      CDS       T01144                                 

Definition
(GenBank) glycosyltransferase involved in cell wall biogenesis
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rmu01003]
    RMDY18_10460
Enzymes [BR:rmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     RMDY18_10460
Glycosyltransferases [BR:rmu01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   RMDY18_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 GA-like
Motif
Other DBs
NCBI-ProteinID: BAI64878
UniProt: D2NTA2
LinkDB All DBs
Position
1146930..1147664
Genome map
AA seq 244 aa AA seqDB search
MRVLTVIPTYNEKENLPVVVERLRKAAPEVDILVVDDNSPDGTGQIADELSAKDSQIHVL
HRTVKDGLGGAYLAGFDWGLEAGYDVLIEMDADCSHQPEQLPSLVRAVEAGADLAIGSRY
VPGGKTKNWPAHRQILSRGANLYTRLILGTSIKDITAGFRAYRRDALQRLNLEGIDSKGY
VFQVDLAWRSEQAGLKIVEVPITFVEREIGASKMDGNIIFDSMSKVTRWGMANRIQKLKK
ALGK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttctaactgtcatcccgacgtataacgagaaggagaacctgcccgtcgtggta
gagcgtcttcgcaaggcagctcccgaggtggatattctcgtggtggatgataacagcccc
gacggtaccggtcagattgctgatgagctgtcggctaaggattcccagattcacgttctg
caccgcaccgttaaggacggtctgggtggcgcatacctcgctggcttcgattggggcctt
gaggcaggctacgacgttctgattgagatggacgctgactgctcgcaccagcctgagcag
cttccttctctggttcgtgctgtggaggcgggcgctgacctggctattggttcgcgttac
gttcccggcggcaagaccaagaactggccggctcaccgccagattctctctcgcggtgct
aacctgtacacccgcctgattctgggcacctccattaaggacattaccgctggtttccgt
gcgtaccgtcgtgacgctctgcagcgcctgaaccttgagggcatcgactcgaagggctac
gtgttccaggttgatctggcgtggcgttctgagcaggctggcctgaagattgttgaggtt
ccgattaccttcgttgagcgtgagattggcgcttcgaagatggacggcaacattatcttt
gactccatgtctaaggtgactcgctggggtatggctaaccgcattcagaagctgaagaag
gctctgggcaagtaa

DBGET integrated database retrieval system