KEGG   Rothia mucilaginosa: RMDY18_11270
Entry
RMDY18_11270      CDS       T01144                                 

Definition
(GenBank) s-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00270  Cysteine and methionine metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01230  Biosynthesis of amino acids
rmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RMDY18_11270
Enzymes [BR:rmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     RMDY18_11270
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N DUF5780
Other DBs
NCBI-ProteinID: BAI64959
UniProt: D2NTI3
LinkDB
Position
complement(1245481..1246695)
AA seq 404 aa
METVSNNHLRLFTSESVTEGHPDKICDQISDAILDGIIAQDPAANVAVETMVTTGQVHVA
GEVTTSSYVEIPSIVRETILGIGYDSSTRGFDGEFCGVSVSIGEQSPDINAGVYESLEVR
QGIAADEYDRQGAGDQGIMFGYASNETNVLMPAPIWLAHRLSERLTKVRKDGLLTELRPD
GKTQVTLGYDSNNVPVSVDTVVVSSQHTASYDLADLRADIEKHVIAPVLGSVELDSSNAK
FIVNPAGRFVQGGPVGDAGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSAAYAMRWV
AKNVVGAGLADRAEVQVAYAIGQAAPVGLYVETFGTEKVDPIKIEKAVREVFDLRPLAII
NELDLRRPIYKKTAAHGHFGRTEPEFTWERLNRVDALRSAVSSS
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtggaaaccgtgagtaataaccatctgcgcctattcaccagcgagtcggtgactgaaggc
caccccgataagatttgtgaccagatttctgacgccatccttgacggcattattgcccag
gatcccgcagcgaacgttgctgtggagaccatggtaaccaccggtcaggtgcatgttgct
ggtgaggtgaccacctccagctacgtcgaaatcccctccatcgtgcgcgagaccattctg
ggtatcggctacgattcctctacccgcggcttcgacggtgagttctgcggcgtgtccgtg
tccattggcgagcagtccccggacattaacgccggcgtgtacgagtccctcgaggttcgt
cagggcattgctgctgacgagtacgaccgccagggtgcgggcgaccagggcatcatgttc
ggttacgcatccaacgagaccaacgtgctgatgcccgccccgatttggctggcgcaccgc
ctctctgagcgtctgaccaaggtccgtaaggacggcctgctgaccgagctgcgccccgac
ggcaagactcaggtgaccctcggctacgattcgaacaacgtgcctgtctccgtggatacc
gtggttgtttcgagccagcacaccgcaagctacgacctggctgacctgcgtgcagacatt
gagaagcacgttatcgcgccggttctgggtagcgtcgagctggattcctccaacgccaag
ttcattgtgaaccccgctggccgcttcgttcagggtggccccgtgggtgacgcgggcctg
accggccgcaagatcattgtggacacctacggcggttcggctcgtcacggtggtggcgcg
ttctccggtaaggacccgtcgaaggtggaccgttccgcagcgtacgcaatgcgttgggtt
gcgaagaacgttgtgggtgccggtcttgctgaccgcgccgaggttcaggttgcgtacgct
atcggccaggcagcgccggtcggtctgtacgttgaaaccttcggcaccgagaaggtcgac
ccgatcaagattgagaaggctgtgcgtgaggtcttcgacctgcgcccgctggcaatcatt
aacgaactggatctgcgccgcccgatttacaagaagaccgcagctcacggccacttcggt
cgtaccgagccggaattcacctgggagcgcctgaaccgcgtggatgcactgcgttcggca
gtgtcctcctcctaa

DBGET integrated database retrieval system