KEGG   Rothia mucilaginosa: RMDY18_11480
Entry
RMDY18_11480      CDS       T01144                                 

Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00770  Pantothenate and CoA biosynthesis
rmu01100  Metabolic pathways
rmu01240  Biosynthesis of cofactors
Module
rmu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RMDY18_11480
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     RMDY18_11480
SSDB
Motif
Pfam: CoaE AAA_33 AAA_18 AAA_29 AAA_28 ATPase ABC_tran
Other DBs
NCBI-ProteinID: BAI64980
UniProt: D2NTK4
LinkDB
Position
1276598..1277314
AA seq 238 aa
MARVSSCMCPPLISTYLLWHSPSGAPSMSQPSSPASTTLRRYALTGGIGSGKSTIAALFV
EQGAFLVDADAISRSLMEPGEAVLARTVAEFGEHLLDEDGRLNRPALARIVFNDEQARLR
LNAIVHPAIRERAAQLVEQAQSEPGFSGVVLEDIPLLVETGDPSAFEGVVVVRTPLATRL
QRLVSSRGMSEEDARARIAAQATDEQREAVATWIIDNGGSLEETAEQVRAVWEQMTAA
NT seq 717 nt   +upstreamnt  +downstreamnt
ttggcgcgagtttcttcctgcatgtgtcctcctctaatcagtacctatctattgtggcac
agcccgtcaggagcaccgtccatgtcccagccttcttcccccgcttctaccacgctgcgc
cgttacgccctcaccggcggtatcggcagtggcaagagcaccatcgccgccctcttcgtg
gagcagggcgcattcctggtggatgcggacgccatctcccgatccctcatggagcccggc
gaggcggtgctcgcccgcacggtcgcggagttcggcgagcatctgctcgatgaggacggc
cgcctcaaccgccccgccctggcgcgtatcgtgttcaatgatgagcaggcgcgcctgcgt
ctgaacgcgattgtgcatcccgctattcgtgagcgtgccgcgcaactggtggagcaggcg
cagtccgaacccgggttcagcggcgtggtgctggaggatattcccctgctcgtggagacc
ggcgacccgtccgcttttgagggcgtggtcgtggtgcgcactcccctggcaactcgcctg
cagcgcctcgtatcgtcgcgcggcatgagtgaggaggatgcgcgcgcccgcatcgccgcg
caggcaaccgacgagcagcgtgaggcggtcgcaacctggattatcgataacggcggctcg
ctggaggaaaccgccgagcaggtgcgcgccgtctgggagcagatgaccgccgcctaa

DBGET integrated database retrieval system