KEGG   Rothia mucilaginosa: RMDY18_12860
Entry
RMDY18_12860      CDS       T01144                                 

Definition
(GenBank) F0F1-type ATP synthase, alpha subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00190  Oxidative phosphorylation
rmu01100  Metabolic pathways
Module
rmu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RMDY18_12860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:rmu00194]
    RMDY18_12860
Enzymes [BR:rmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     RMDY18_12860
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     RMDY18_12860
Photosynthesis proteins [BR:rmu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   RMDY18_12860
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N TniB
Other DBs
NCBI-ProteinID: BAI65118
UniProt: D2NTZ2
LinkDB
Position
complement(1449715..1451361)
AA seq 548 aa
MREQGHKMAELTINAEDVRNALNEFAASYEPGNAERVEVGRVVSASDGIARVEGLPSVMA
NELLRFEDGTLGLAQNLDTRNIGVIVLGDFTGIEEGQVVHRTGEVLSVPVGDAYLGRVVD
PLGNPIDDLGPIEAEGRRALELQAPGVTQRKSVHEPLQTGLKAIDSMIPIGRGQRQLIIG
DRQTGKTAIAIDTILNQKDNWASGDPEKQVRCIYVAVGQKASTIAAVRHTLETRGALEYT
TIVASPASDAAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPP
GREAYPGDVFYLHSRLLERCAKLSDDLGAGSMTGFPIIETKANDVSAFIPTNVISITDGQ
IFLQSDLFNANQRPAVDVGISVSRVGGAAQTKAMKKVSGTLKLELAQYRAMEAFAMFASD
LDDATKAQLTRGSRLTELLRQPQYTPYAVEEQVVSIWAGTSGHLDDIEISDVLRFEAGFI
EYLRHKTSVLTDIASSGKLEDDTVAALKSAVADFKQGFKSEGSSHLVDAGHEEHKAARDS
DITQETIG
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagagagcagggacacaagatggccgaactgaccatcaatgccgaagatgtccgtaat
gcgctgaacgagtttgcagcgtcttacgaacccggcaatgcagaacgtgttgaggtgggt
cgagttgtatcggcctccgacggtatcgctcgtgttgagggtcttccctcggttatggcg
aatgagctgcttcgtttcgaagacggcaccctcggcctcgcacagaacctggatacccgc
aatattggtgtgattgtcctgggtgacttcaccggtattgaagagggccaggtcgtacac
cgcaccggtgaggtcctctcggtgcccgttggcgacgcgtacctcggtcgcgttgttgac
cccctcggtaacccgatcgatgacctgggccccatcgaggccgaaggtcgccgtgcactg
gagctgcaggctcccggcgtgacccagcgtaagtcggttcacgagccgctgcagaccggt
ctgaaggcaatcgactcgatgattccgatcggtcgcggtcagcgtcagctgattattggt
gaccgccagaccggtaagaccgctatcgcgatcgacaccattctgaaccagaaggacaac
tgggcttccggtgaccccgagaagcaggttcgatgcatctacgtggctgttggccagaag
gcatccaccatcgcagctgtccgccacacccttgagactcgcggcgcgctggagtacacc
accatcgtggcatctcctgcatccgacgcagcaggcttcaagtacctggcaccctacacc
ggttcggctatcggccagcactggatgtacggtggcaagcacgtcctcatcatcttcgac
gacctgtcgaagcaggcagaagcataccgcgctgtgtccctgctgctgcgccgcccgccg
ggacgtgaagcataccccggtgacgtcttctacctgcactcccgcctgctggagcgttgc
gctaagctctccgacgacctgggcgcaggttcgatgaccggcttcccgatcattgagacc
aaggcaaacgacgtttccgccttcatcccgaccaacgtcatctccattactgacggccag
atcttcctgcagtccgacctgttcaacgctaaccagcgtccggcagtcgacgtcggtatc
tccgtctcccgtgttggtggtgccgcacagaccaaggctatgaagaaggtctccggtacc
ctgaagctggagctggcacagtaccgtgcaatggaagcgttcgcaatgttcgcatccgac
ctggacgacgctaccaaggcacagctgacccgcggttctcgcctgaccgagctgctgcgt
cagccgcagtacaccccgtacgcagttgaagagcaggttgtctccatttgggctggtacc
tccggtcacctcgacgacatcgagatttccgacgtgctgcgcttcgaggcaggattcatc
gagtacctgcgtcacaagacctcggtactgaccgatatcgcttcctccggcaagcttgag
gatgacaccgttgcagctctgaagtccgcagttgctgacttcaagcagggtttcaagtct
gagggcagcagccacctcgtcgacgcaggtcacgaggagcacaaggcagctcgcgatagc
gacatcactcaggaaaccatcggttag

DBGET integrated database retrieval system