KEGG   Rothia mucilaginosa: RMDY18_14460
Entry
RMDY18_14460      CDS       T01144                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00300  Lysine biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    RMDY18_14460
Enzymes [BR:rmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     RMDY18_14460
SSDB
Motif
Pfam: DAP_epimerase
Other DBs
NCBI-ProteinID: BAI65278
UniProt: D2NNR0
LinkDB
Position
complement(1625206..1626141)
AA seq 311 aa
MSENPSIWGELAGLTLTKGHGTGNDFIFLTDENAEIALTPELVARACDRHFGIGADGFIR
AARSTASRAGQKLIEEHPDAVWFMDYRNGDGSVAEMCGNGVRAFVEYLRTEGLIELEVGE
TVKIGTRAGVKTVARTEEGYAIDMGPWSFIHGDAAREGGEDCLVSARGLKTPRAGLSISM
GNPHTVVMLGSEGKLDGLDLHSLPQVNPAPVNGTNVEFVVPVDLDVESGAHVGAIRMRVH
ERGVGETLSCGTGACAAAAATRFWGGEEAPDEWLVHVPGGTLAVTFVLGPDDLEHVVLAG
PAQMVATVVLR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagcgagaacccttccatctggggcgagctggcaggcctgaccctcaccaagggtcac
ggcaccggtaacgacttcatctttctgacggatgagaacgcagaaattgccctcaccccc
gagctggtagcccgcgcctgcgaccgacacttcggcattggcgcggacggcttcattcgt
gcagcccgcagcaccgcctcccgcgcgggtcagaagctgattgaggagcacccggacgct
gtctggttcatggactatcgcaacggtgacggctctgtcgctgaaatgtgcggcaacggt
gtgcgcgcgttcgtggagtacctgcgtactgagggtctgattgagcttgaggtgggcgag
accgtcaagatcggtacccgtgccggcgtgaagactgtggcgcgcaccgaagagggctac
gcgattgatatgggtccgtggagcttcattcacggtgacgctgcccgcgagggtggcgag
gactgcctggtgtctgctcgcggcctgaagactccgcgcgctggcctgtccatttcgatg
ggtaacccgcacaccgtggtcatgctcggctccgagggtaagctggacggcctggacctg
cacagcctgcctcaggtgaaccccgccccggtcaacggtacgaacgttgagtttgtggtg
ccggtcgacctggatgttgagagcggcgcgcatgtgggcgctatccgtatgcgcgtgcac
gaacgcggcgtgggcgagaccctgtcctgcggtaccggcgcgtgtgcggcggctgcggcg
actcgtttctggggtggcgaggaagcaccggatgagtggctggtgcatgtgcccggcggt
accctcgcggtgactttcgtgctgggcccggatgacctggagcatgttgttctggctggt
ccggcgcagatggttgcgaccgtcgtgctgcgatag

DBGET integrated database retrieval system