KEGG   Rothia mucilaginosa: RMDY18_14640
Entry
RMDY18_14640      CDS       T01144                                 

Definition
(GenBank) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00261  Monobactam biosynthesis
rmu00300  Lysine biosynthesis
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    RMDY18_14640
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    RMDY18_14640
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     RMDY18_14640
SSDB
Motif
Pfam: DapB_C DapB_N Sacchrp_dh_NADP Semialdhyde_dh Radical_SAM NAD_binding_3
Other DBs
NCBI-ProteinID: BAI65296
UniProt: D2NNS8
LinkDB
Position
complement(1644022..1644888)
AA seq 288 aa
MACTAPTRGIIEAVRHSVYPIVGVLISYGGEKMAHEDDEKIWKVAVLGAAGRMGSEAVRA
VNTSADMDLVAALGRGDDLQELVDAGAEIVIDLTVPESSEANVRFAVEHGMHAVVGTTGW
TPERLDSLRELLVEHPEVGVLIAPNFAIGSILATEFAAKAARYFESVEIIEIHHPNKVDA
PSGTAVHTARKVAAARAEAGVGASPDATTSDPLGSRGAVVDDIHVHAVRLRGMVAHQEIL
LGDPGQQLVIRHDSFDRVSFMPGVLLGVREVAAHPGLSVGLDAYMDLS
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcgtgcaccgcgcccacacgggggataatagaggctgtacgtcacagcgtctacccc
attgtcggggtgctcataagttacggaggagagaagatggcccacgaggacgacgaaaaa
atctggaaggtagcggtactcggtgccgcgggccgtatgggttctgaggcggtgcgcgcc
gtcaacacctccgcagacatggacctggtggcggcactgggccgtggcgatgacctgcag
gagctggtcgatgccggcgcagagattgttattgacctgacagttcccgaatccagcgag
gcgaatgtgcgtttcgcggtggagcacggtatgcacgcggtggttggtacgaccggttgg
acccccgaacgcctggactccctgcgcgagctgctggtagagcaccccgaggtgggtgtg
ctcatcgccccgaacttcgcgattggttcgattctcgccaccgagttcgcggcgaaggcg
gcacgctacttcgagtctgtagagattattgaaattcaccacccgaataaggtagatgcc
ccctccggtaccgctgtgcacaccgcccgcaaggtggctgccgcccgcgcggaggctggt
gtgggtgcaagcccggacgccaccacctccgatcctttgggctcgcgcggtgccgtggtc
gacgatattcacgtacacgcggtgcgtctgcgcggcatggtggcgcatcaggagattctg
ctgggcgatcccggtcagcagctcgtgattcgtcacgattcctttgaccgtgtctccttc
atgcccggcgtgctgttgggtgtgcgtgaggtggcggcgcatccgggtttgagcgtgggc
ttggacgcctacatggatttgtcctag

DBGET integrated database retrieval system