KEGG   Rothia mucilaginosa: RMDY18_14730
Entry
RMDY18_14730      CDS       T01144                                 

Definition
(GenBank) nucleoside phosphorylase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00270  Cysteine and methionine metabolism
rmu01100  Metabolic pathways
rmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RMDY18_14730
Enzymes [BR:rmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     RMDY18_14730
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-ProteinID: BAI65305
UniProt: D2NNT7
LinkDB
Position
complement(1654151..1655065)
AA seq 304 aa
MGAGDGVMSAQIPDAFASAFNPVDFDPNAFDPAEAFNSMFELMDGMSNAIIIQVAMDEEL
APFLKVTEELQPSFTEGAAVFHPRYLQVGEDQVPLLLVRSKIGLVNAASAVTEAISYSSN
CLGVISAGTAGGLARGINVGDVLIGENYTYTDADATAFGYARGQVPGMPESYDGQADEWQ
DALEHALAALEPVREQAESTWEVRRGQMLAGNSFVTAHNVKDTREAFEGAISTDMETTAI
AQVCHNYEIPFIGVRCVSDLCGPEADQDFHLSVDVVAPRSARYALQLAAELWTEAQLEAL
ELAL
NT seq 915 nt   +upstreamnt  +downstreamnt
gtgggcgcaggtgatggcgtaatgagcgcacagatccctgacgctttcgcatccgccttc
aacccggtggacttcgacccgaacgctttcgacccggctgaggcattcaacagcatgttt
gagctgatggacggcatgtccaacgccatcatcattcaggtggctatggatgaggagctc
gcacccttcctgaaggtcaccgaggagctgcagccctccttcaccgagggtgcggcggta
ttccacccgcgctacctgcaggtgggcgaggaccaggttccgctactgctggttcgctcc
aagatcggtctggtgaacgcggcgagcgccgtcaccgaggcgatcagctactcctcgaac
tgcctgggcgtcatcagcgcaggtaccgccggcggtttggctcgcggcattaacgtgggc
gacgtgctgattggcgagaactacacctacactgacgccgacgcgaccgcgttcggttac
gcgcgcggccaggttccgggcatgcccgaaagctacgacggtcaggcggacgagtggcag
gatgccctggagcatgcgcttgccgcactggagccggtgcgtgagcaggctgagagcacg
tgggaggtgcgccgcggccagatgctggcgggtaactccttcgtaaccgcccacaacgtg
aaggacacccgcgaggcgttcgagggtgccatcagcaccgacatggagaccaccgctatt
gcgcaggtctgccacaactacgagattccgtttatcggagtgcgttgcgtgtctgatctg
tgcggcccggaggctgaccaggacttccacctctccgtggacgtggtggctcctcgttcg
gctcgttacgctctgcagctggctgctgagctgtggactgaagcgcagctggaggcgctg
gagctggctctctaa

DBGET integrated database retrieval system