KEGG   Rothia mucilaginosa: RMDY18_14740
Entry
RMDY18_14740      CDS       T01144                                 

Definition
(GenBank) LuxS protein involved in autoinducer AI2 synthesis
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00270  Cysteine and methionine metabolism
rmu01100  Metabolic pathways
rmu01230  Biosynthesis of amino acids
rmu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RMDY18_14740
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RMDY18_14740
Enzymes [BR:rmu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     RMDY18_14740
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-ProteinID: BAI65306
UniProt: D2NNT8
LinkDB
Position
complement(1655044..1655604)
AA seq 186 aa
MPSDETSCAVRLDVLRLPRGTPVLVVPVLREDRVMEKMNVESFNLDHRAVAAPYVRIADR
KVLPGGDTLIKYDIRFTQPNTAHLEMPTVHSIEHLSAEHMRNHTDRLIDFSPMGCQTGFY
ALTLGLEPEKFFPILEATLNDILNATEVPAANEVQCGWGANHTLEGAQAAAREFLAARDE
WAQVMA
NT seq 561 nt   +upstreamnt  +downstreamnt
gtgccttccgacgaaacctcgtgcgccgtacgccttgacgtcctgcgcctcccgcgaggc
acccctgttttagtcgtccccgttttaagagaagatagagtcatggaaaaaatgaacgtc
gaatccttcaatctcgaccaccgcgccgtagcagcaccctacgtgcgtatcgcagaccgc
aaggtcctgcccggtggcgacaccctcatcaagtacgatatccgcttcacccagccgaac
accgcgcacctggaaatgccgaccgtgcactccatcgagcacctgagcgccgagcacatg
cgcaaccacaccgaccgtctgattgacttctccccgatgggttgccagaccggtttctac
gcgctgaccctgggcctggagcccgagaagttcttccccatcctggaagcaaccctcaac
gatatcctcaacgcaaccgaggttccggcagcgaacgaggtgcagtgcggttggggcgcc
aaccacaccctcgaaggcgcgcaggctgcggctcgcgagttcctcgcggcacgcgatgag
tgggcgcaggtgatggcgtaa

DBGET integrated database retrieval system