KEGG   Rothia mucilaginosa: RMDY18_15340
Entry
RMDY18_15340      CDS       T01144                                 

Definition
(GenBank) biotin-(acetyl-CoA carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00780  Biotin metabolism
rmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RMDY18_15340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rmu03000]
    RMDY18_15340
Enzymes [BR:rmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     RMDY18_15340
Transcription factors [BR:rmu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    RMDY18_15340
SSDB
Motif
Pfam: BPL_C BPL_LplA_LipB BNR_4
Other DBs
NCBI-ProteinID: BAI65366
UniProt: D2NNZ8
LinkDB
Position
complement(1718348..1719463)
AA seq 371 aa
MLHAPSLSNVPSRATGGHHRRQEIDMVRNQCDSVETGRFWRRVGVLQSNFGQDRKVQAME
ENMYTESDHSVLDAPRIRTIAMETGYCSVNLYDEVDSTTTRARELLMDGTDPEREQLGEL
SVYASLYQSAGRGRLARAWTAPAGACLAASIVVRPHASTDPLARELPEDSYHWLTLIAGL
SVVDIWRSYGVDAALKWPNDVIAQGAKGCGILAQLVPESGSTEGQRSIIVGIGQNTNMSA
EQLPVPTATSLSLCTGAAVDSSEVLTRLLSIFARRYRAFVRAGGDPERPDPLTPDSLSLL
DHARAATATLGASVRMSLPDGSTVEGTAEDLDAQGRILIRREDGALEPYAVGDIEHLRPA
NGSYGDFQQAH
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgcttcatgcaccctcactgtctaatgtaccgtctcgggcgacgggtgggcatcaccgg
cggcaagaaattgatatggtgagaaaccagtgcgactcggtagaaaccggcaggttttgg
cggcgggtcggagtactgcagagtaatttcgggcaggacagaaaggtacaagctatggag
gagaatatgtacaccgagagcgatcattcggttttggatgcgccacgcatccgcaccatt
gcaatggaaaccgggtactgtagcgtcaacctctacgatgaagtcgactccaccaccacc
cgcgcccgcgagctacttatggacggcacggaccccgaacgcgaacagctcggcgagctc
tccgtctacgccagcctctaccaaagcgccggacgcggccgcctcgcccgagcctggacc
gcccctgccggtgcctgcctcgccgcaagtatcgtggtgcgcccgcacgcctccacagac
cctctcgcccgagaactacccgaagacagctaccactggctgaccctcatcgccgggctc
agcgtggtcgatatttggcgtagctacggggtagacgccgccctcaaatggcccaacgac
gtgatcgcacagggcgccaaaggctgcggaattctcgcccagctcgttcccgaaagcggc
tccaccgaggggcagcgcagcattattgtgggtatcggccagaacacgaacatgtccgcc
gaacagctgcccgtacctaccgccaccagcctgagcctgtgcacaggtgccgcggttgac
tcctccgaggtgctcacccgactgctgagcatcttcgcccgccgctaccgcgccttcgtg
cgcgccggtggcgaccctgaacgccccgacccgctcacccctgatagcctcagcttgctt
gaccatgcgcgcgccgccaccgcaaccctcggcgccagcgtgcgcatgagtctgcccgac
ggaagcaccgtagaaggcaccgccgaagacctcgacgcgcaggggcgcatcctcatccgc
cgcgaggacggggccctagagccctacgcggtgggcgatattgagcatcttcgccccgcc
aacggtagctacggagattttcagcaggcacactag

DBGET integrated database retrieval system