KEGG   Rattus norvegicus (rat): 100359816Help
Entry
100359816         CDS       T01003                                 

Gene name
Setd1b
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100359816 (Setd1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100359816 (Setd1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100359816 (Setd1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100359816 (Setd1b)
   HMT complexes
    COMPASS/SET1 complex
     100359816 (Setd1b)
    COMPASS/SET1 complex (yeast)
     100359816 (Setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5 Macoilin
Motif
Other DBs
NCBI-GeneID: 100359816
NCBI-ProteinID: XP_008759105
RGD: 2323325
LinkDB All DBs
Position
12q16
AA seq 1982 aa AA seqDB search
HHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSSNRPVEI
VEDPRVVGIWSKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYG
EVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMR
FYELLVTGRYTPQTLPVGELDAISPIVSETLQLSDALKRLKDGNLSAGCGSGSSSVTPNS
GGTPFSQDTAYSSCRLDTPNSYGQGTPITPRLGTPFSQDSSYSSRQPTPSYLFSQDPAAT
FKARRHESKFTDAYNRRHEHHYVHNSAVAAAVAGATAPFRGSSDLSFGTVGGSGGGTPFK
TQSQDSTTYAHTPPPAQTATASGFKSAFSPYQTPAPPFPPPPEEPTATAAFGTRDSGEFR
RAPAPPPLPPSEPPAKEKPGTPPGPPPPDNNSMELGGRPTFGWSPEPCDSPGTPTLESSP
AGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTEIQMEGSPISSSSSQLSPLTHFGTN
SQPGFRGPSPPSSRPSSTGLEDISPTPLPDSDEDDDLGLGLGPRPPPEPGPPDPMGLLGQ
TAEVNLDLAGDRTPTSERMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAV
AAPNVLAPNLPLPPXXXXXXXXPPPPPQPGFPMPPPLPPPPPPPPPPAHPAVTVPPPPLP
APPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQGT
CPYPPFMAAAAAAASAGLQFVNLPPYRSPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYIP
RQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPV
KSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPD
TASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKSVGVRRRPGRPLELDS
GGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEEEERESTEEEEEEEEAEEEEEDE
ERPRSHISSPSSSSSSDKDDDDDDDSDDQIDSDIDDQGTALSVASEKDNVDSEEEEIERV
TTSKAPAVSSSSSSSSSSSESSGSSEFDSSSESSSSSSSSEDEDEMTVPGEDEEEEEEEE
EKETAMATATVVAMAEESMPPVGGQDFEQDRAEVPLGPRGPLRESLCTEEEVDIEAEDEV
PEMQAPVPEESPLPMGAQELSPEPPEEPSPNTQGDMLLSPELPARETEAQPPSLPEHGPE
SDLEVEPEPPPMLSLPLQPPLLPPRHPRPPSPPPEPETPEPPKPPVPLEPPPEDQPPRTP
GLCGSLAKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPSPSPGLSSGGLPR
TPGRDFTFTPTFPEPSGPLLLPVCPLPTGRRDERAGPLASPVLLETGLPLPLPLPLPLPL
ALPVPVLRAQPRPPPQLPPLLPATLAPCPTPIKRKPGRPRRSPPSMLSLDGPLVRPPPGP
ALGRDLLLLPGQPQAPIFPSAHDPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVEPTK
LPFKELDNQWPSEAIPPGPRRDEVTEEYMDLAKVRGPWRRPPKKRHEDLVAQSASPEPSP
PQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPS
TSLSSAKKKKREDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGMSIP
AQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAM
EPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFI
NHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGT
LN
NT seq 5949 nt NT seq  +upstreamnt  +downstreamnt
caccaccaccaccagcagcccccgccgcagcccggcccttcgggcgagaggaggaaccac
cattggagaagttacaagttgatgattgacccggctctgaaaaaggggcaccataaactg
taccgctacgatgggcagcatttcagcctggcgatgtccagcaaccgcccggtggaaatc
gtggaagatccccgggtggtcggcatctggagcaaaaacaaggagctggagctgtcggtg
cccaaattcaagatcgatgagttctacgtgggccctgtgcctcccaagcaggtgacattt
gccaagctgaatgacaacatccgcgaaaacttcctaagggacatgtgcaaaaagtatggg
gaagttgaggaggtggagattttgtataacccgaagaccaagaaacacctgggcatcgcc
aaggtagtctttgccacggtcaggggcgccaaggaggcagtccaacacttgcatagcact
tctgtcatgggtaacatcatccacgtggagctggacaccaaaggggaaactcgcatgcgc
ttctatgaactgctggtcaccggccggtacacccctcagaccctcccagtgggtgagctg
gatgctatttctccaattgtgagcgagaccctgcagctctcggacgctctgaagcggctc
aaagatggtaacctgtccgcaggctgtggctctggctcctcctcggtcacccccaatagt
ggcgggacccccttctcccaggatacagcctactccagctgccgtctggacacacccaac
tcctacggacaaggcaccccgatcacgccccgcctgggcacccctttctcccaagattcc
agctattccagtcgtcagcccacaccctcctacctcttcagccaggaccccgcagcaact
ttcaaggccaggcggcacgagagcaagttcacagatgcctataaccgccgtcatgaacac
cattatgtccacaattccgcggtggcagctgcggtggcaggagccacggctcctttccga
ggctcctcagacctctcttttgggacagttggcggcagtggcggcggcactcccttcaag
actcaatcccaggattccaccacatatgcccatactccacctcctgcccaaacagccact
gcttccggattcaaatcagccttttctccataccagactccagcacccccattcccgcca
ccccccgaggagcccactgccacagcagccttcgggacccgcgacagtggggagttccgg
agggcacccgcgcccccacccctgccgccctctgagcctccagccaaggagaagccgggc
acacctcccggtcccccaccccctgacaacaacagcatggagctgggtggtaggcctacc
tttggctggagtcctgagccctgtgacagccctggcactcctactctggagtcttctcca
gcgggaccagagaagccccatgacagcctggactcccgcattgagatgctgttgaaggaa
caacgcaccaagctgcccttcctgcgggagcaggactcagacaccgagatccagatggaa
ggcagccccatctcctcctcctcctcccagctctccccactcacccactttggcactaac
tcccagcctggcttccgtggcccctcgccaccctcctcacgcccctctagcacgggccta
gaggacatcagccctacaccactgcctgattccgacgaggatgatgacctgggcctgggc
ctcgggcctcggcccccacctgagccaggccccccagaccctatgggtcttctaggccag
acagctgaggtgaatttggacctggcaggagacaggaccccgacctcagagcggatggat
gagggccagcagtcctctggagaggacatggaaatctcagacgatgagatgccctcagcc
cccatcaccagcgctgactgccccaagcccatggtggtgaccccaggggcaggggctgtg
gcagcccctaatgtgcttgctccaaacctgcccctgcccccannnnnnnnnnnnnnnnnn
nnnnctcccccacccccaccgcaacctggcttccccatgcccccacctttgccgccgcca
ccaccaccaccaccaccaccagcccatcctgcagtgacagtccccccgccacccttgcca
gcgcccccgggtgtcccacccccacccatccttccaccactgccgcccttcccgccagga
ctgtttcctgtgatgcaggtggacatgagccatgtgctgggtgggcagtggggcggcatg
cccatgtccttccagatgcaaacacagatgttaagccggctcatgacaggccagggtact
tgcccctacccacccttcatggccgctgccgccgctgccgcttctgctgggctacagttt
gtcaacttgcccccctaccggagcccgttctccctgagcaacagtggcccaggacgtgga
cagcactggccgcccctgcccaagtttgacccctctgtgccaccaccaggctacataccg
cgtcaggaggatccgcacaaggccacagtggatggggtcctgctagtagtgctcaaggaa
ctgaaggccattatgaagcgggatctcaaccgcaagatggtggaggtggtggccttccgg
gcctttgacgaatggtgggacaaaaaggagcggatggccaaggcctcactgacccccgtg
aagtctggtgagcacaaggatgaggacaggccaaagcccaaagaccgaatcgcctcctgc
ctgctggaatcatggggcaagggcgagggcctgggttacgagggcctaggcctgggcatt
ggactacggggcgccattcgcctgccctccttcaaggtcaagaggaaggagccaccggac
acagcctcttctggcgaccagaagcggctgcggccttcaacctctgtggatgaggaagat
gaagagtcggaacgggagcgtgaccgggacatggctgatgccccgtgcgaactcgccaag
cgggaccccaaaagtgtgggtgtgcgacgccggccaggacggcccctggagctggacagc
ggtggggaggaggacgagaaggagtccttgtccgtgtcctcatcttcctcagcatcctca
tcctctggatcttccacaacctcaccctcatcctccgcctcggacaaggaagaggaggaa
cgagaaagcactgaggaggaggaagaggaagaggaagcagaggaagaggaggaggatgaa
gagcgccccaggagccacatatcctccccctcatcctcatccagctctgataaggatgat
gatgatgatgatgacagtgatgaccagattgattctgacatcgacgatcagggtacagcc
ctgtcggtggccagtgagaaggacaatgttgattctgaggaagaggagatagagagagtc
accacctccaaggccccggctgtgtcatcgtcgtcatcgtcgtcgtcgtcctccagtgaa
agttctggatcttctgaattcgattccagttctgagtcctcatcctcatcttcatcctcg
gaggatgaagacgagatgactgtacctggggaagacgaggaagaggaggaggaggaggag
gagaaagagaccgcaatggctacagcgacggtagtggcgatggccgaggagagcatgcct
ccagtgggcggccaggactttgagcaggatagggcagaagtgcctctgggcccaagaggc
cccctgagggagtccttgtgcacagaagaggaagtggacattgaggccgaggacgaagtc
cccgagatgcaggctcctgtgccggaagagtctccattgcccatgggtgctcaggaactg
agccccgagcccccagaagagccaagcccaaacacacaaggggacatgttgctctctcca
gaactccctgccagggagacagaagctcaacccccatcactccctgaacatggtccagag
tcagacctggaagtggagcccgagccccctccgatgctctccttacccttgcagccacca
ttgctaccccctcgacatccccggccacccagcccaccacctgagcccgagaccccagag
ccccccaaacctcctgtccccctggagcctcctcccgaagaccagcctccacgtaccccg
ggcctctgtggcagtctggccaagtcacagagcacggagacagtgccggccaccccgggc
ggggagcctccactgtcagggggcagcagtggcctgtcactgagctccccgcaggtgcct
ggcagcccgttctcatacccttccccgtcccctggcttgagcagtgggggccttccacgg
acacctggtcgggacttcaccttcacacctaccttccctgagcccagtgggcccttgctt
ctgcctgtctgccccctccccactggtcgacgagatgagcgcgctggccccctggcctcc
ccagtgctcctggaaactggcctgcccctcccccttcccctgcctctgcccttacctctg
gcattgcctgtccctgtcctgagggcccagcctcggccgcctccccagctgcctccctta
ctgcctgctaccctagctccctgcccaacccccatcaagaggaagccaggccggccccgg
cgatccccaccatctatgctgtccttggatggacctttggtccggccaccaccagggcct
gcccttgggagggaccttctgctcctgccaggccaaccacaggcccccattttccccagt
gcacatgatccccgggccgtgaccttggacttccggaacacggggatcccagccccccca
ccgcccctcccaccccagcctcctccacccccgccaccaccacctgttgagcccaccaag
ctgcccttcaaggagctggacaaccagtggccctctgaagctattcccccaggacctcgc
cgagatgaggtcactgaagagtacatggacctggccaaggtgcggggaccatggcgacgg
ccacctaagaagcgccacgaagacctggtggcccaatcagcctcacccgaaccctcacca
ccccagcctctcttccggccccgctcagagtttgaggagatgaccatcctgtatgacatc
tggaatggtggcattgatgaggaggacatccgcttcctatgcgtcacctacgagcgcctg
ttgcagcaggacaatggcatggactggctgaatgacacactctgggtctaccatccctcc
accagcctttcctcagccaagaaaaagaaacgggaggacggtatccgtgagcacgtgaca
ggctgcgcccgaagcgagggcttctacaccatcgacaagaaagacaagctgagatacctc
aatagcagccgtgccagcacagatgagccccccatggatacccagggtatgagcatccca
gcacagccccatgcctctacccgggcaggctcagagcggcggtctgagcagcggcgcctc
ctgtcctccttcaccggcagctgtgacagtgacctgctcaagttcaaccagctcaagttt
cggaagaaaaagctcaagttctgtaagagccacattcacgactggggcctgtttgccatg
gagcccatcgctgccgatgagatggtcattgagtacgtgggtcagaacatccgccaggtg
attgcagacatgagggagaaacggtacgaggacgaaggcatcggtagcagctacatgttc
agggtagaccacgacaccatcatcgacgccaccaagtgcggcaactttgcgcggttcatt
aatcacagctgcaatcccaactgctatgccaaggtgatcacggtggagtcccagaagaaa
attgtcatctactccaagcagcacatcaatgtcaacgaggagatcacatatgactataag
ttccccattgaggacgtcaagataccctgcctctgtggctccgagaactgccgggggacc
ctcaactag

DBGET integrated database retrieval system