KEGG   Rattus norvegicus (rat): 100364027Help
Entry
100364027         CDS       T01003                                 

Definition
(RefSeq) hexokinase 1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100364027
   00051 Fructose and mannose metabolism
    100364027
   00052 Galactose metabolism
    100364027
   00500 Starch and sucrose metabolism
    100364027
   00520 Amino sugar and nucleotide sugar metabolism
    100364027
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100364027
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100364027
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100364027
  Digestive system
   04973 Carbohydrate digestion and absorption
    100364027
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100364027
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100364027
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100364027
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100364027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 Pyridoxal_deC VPS13_mid_rpt CSD
Motif
Other DBs
NCBI-GeneID: 100364027
NCBI-ProteinID: XP_017443500
RGD: 2321830
LinkDB All DBs
Position
20q11
AA seq 886 aa AA seqDB search
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKQNVQMESQFYPMPNEITR
GNGTELFDYVADCLADFMKTKDLTHKKLPLGFTFSFPCRQNKLEEGFLLSWTKKFKARGV
QDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILVDLG
LDPSESDCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLARLRTTVGMDGTLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFHLT
REQLLGVRDKMRAELEYGLKKKTHALATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRV
LLVKIRKRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFS
FPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMM
TCGYEDPRCEIGLIAGTWRLWLAFHTQNSILREHFSALTSLIPSSPNRYEKMTSGMYLGE
IVRRILIDLTRQGLLFRGQISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDST
CEDSIVVKEVCGAVSRRAAQMCGAGMAAIVEKRREDQGLQHFKVTVGVDGTLYKLHPHFS
RILQETVKDLAPQCDVTFMLSEDGSGKGAALITAVAKRLQQLPKDN
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagttcacttagtggcgttttacttcaccaagctgaaagaggaccagatcaag
aaggtggacaggttcctgtaccatatgcggctctcggatgagacccttgtggacatcatg
gcccgattccaggccgagatggagaaaggcttagggaaggacaccaaccccactgcctca
gtgaagatgctgcccacattcgtcagggccattccagatggctcagaaaacggggaattc
ctttccctggatctcggagggtccaagtttcgggtcctgaaggtgcaagtctcggaagag
ggcaagcaaaatgtccagatggagagccagttctacccaatgcccaatgaaatcacccgt
gggaatggcacggagctctttgactatgtagctgactgcctggcagatttcatgaagacc
aaagatctgacgcacaagaagctgcctctgggcttcaccttttcttttccctgcagacag
aataagttggaggagggcttcctgctgtcatggaccaagaagttcaaggcccggggagtt
caggacacagacgtggtgaaccgtctggccaccgccatgaaaaagcacaaggacctggac
gtggacatcctggccttggttaacgacactgtggggaccatgatgacttgtgcttatgat
gatcccaactgtgaggtcggcgttatcattggaacaggcaccaacgcgtgttacatggag
gacatgagcaacatcgaccttgtggaaggggacgagggaaggatgtgcatcaacacggag
tggggggccttcggggacgatggcactttggaggacattcgcaccgagtttgacagagag
ttggacctgggctcactcaaccccgggaagcagctgttcgagaagatgatcagcgggctg
tacatgggggagctggtcaggctcatcttgctgaagatggccaaagttggtctcctgttt
gggggtgcaaagtcctccgctctccacacaaagggcaagattgaaacacagcacgtggct
gccatggagatgagtaaagaaggcctggccaatacgagagagatcctggtggatttgggc
ctggacccctctgagtcagactgcatcgctgtccagcacgtgtgcaccatcgtctctttt
cgctcggccaatctctgcgccgctgcgctggcagccatcttgactcgcctccgagagaac
aagaagctggcccggctccgcaccacggtgggcatggatggaaccctctacaaaacacac
cctcagtaccccaaacgcctacacaaagtggtgaggaggctggtcccaaactgtgatgtc
cgcttcctcctatcagagagcggaagcaccaaaggggctgccatggtgaccgcagtggcc
tctcgggtgcaggcccagcgtaagcagatcgataaggtgctggctttgttccatttgacc
cgagagcaactcctgggtgtgcgggacaagatgcgggctgaacttgagtatgggctgaag
aaaaaaactcacgctctggctacagtgaagatgcttcccacctacgtctatgggatgccc
gatggcacagagaaaggaaagttccttgccctggacttggggggaactaacttccgcgtc
ctccttgtaaagatcaggaagaggtcggtgcgaatgtacaacaagatctttgccatccct
ctggagatcatgcagggcactggagaggagctctttgaccacattgtgcagtgcatcgct
gacttcctggactatatgggcctcaagggcgcccagctgcctttgggcttcacattctcc
ttcccctgcagacaaacatgcatcgacaaggggactctagtaggatggaccaaaggcttc
aaggccaccgactgtgaaggggaggacgtggtggacatgctcagagaagccatcaagagg
agaaacgagtttgacctggacatagttgcaatcgtgaatgacacggtggggaccatgatg
acctgtggctatgaggatccccggtgtgagattggcttgattgcaggtacgtggcgcctg
tggcttgctttccacacccagaacagcatcctcagagagcacttttctgcccttaccagt
cttatcccctcttccccaaacaggtacgagaaaatgaccagtgggatgtacctgggggag
attgtgaggcggatcctgatcgacctcacccggcaggggctcctcttccgagggcagatt
tcagagcgactccggaccaggggtatctttgaaaccaaattcctgtctcagattgaaagt
gaccggctggccctcctgcaggtcaggaggatcctgcagcagctgggcctggacagcacc
tgcgaagacagcattgtggtgaaggaggtgtgcggggctgtgtctcggagggctgcccag
atgtgcggcgccggcatggctgccatcgtggagaaaaggagagaagaccagggcctccag
cacttcaaggtcactgtgggcgtggacggcaccctgtacaagctgcacccacacttctcc
cggatactgcaggagacagtgaaggacctggctcctcagtgcgacgtgactttcatgttg
tcagaagacggcagcgggaagggagcagctctgatcacagctgtagccaagaggttacag
cagctgccgaaggacaactag

DBGET integrated database retrieval system