KEGG   Rattus norvegicus (rat): 100911727Help
Entry
100911727         CDS       T01003                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno03410  Base excision repair
rno03420  Nucleotide excision repair
rno03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100911727
   03410 Base excision repair
    100911727
   03420 Nucleotide excision repair
    100911727
   03430 Mismatch repair
    100911727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    100911727
   03400 DNA repair and recombination proteins [BR:rno03400]
    100911727
Enzymes [BR:rno01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100911727
    6.5.1.6  DNA ligase (ATP or NAD+)
     100911727
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100911727
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100911727
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100911727
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100911727
   NER (nucleotide excision repair)
    Other NER factors
     100911727
   MMR (mismatch excision repair)
    Other MMR factors
     100911727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR Presenilin
Motif
Other DBs
NCBI-GeneID: 100911727
NCBI-ProteinID: XP_008757316
RGD: 6491367
Ensembl: ENSRNOG00000047206
LinkDB All DBs
Position
1q21
AA seq 857 aa AA seqDB search
MGPQLKLPGGGIYLLYSKTVLSVCFQKPVSDSKQSSPPSPDSCPENSSPSMDISPSGFPK
RRTARKQLPKRTIQDTLEEHNEDKDKAAKKRKKEDTQTPTESLTEAEEVKQKEEQVEDQP
TVPPEPTESPESVTLTKTENIPMCKAGVKQKPQEEEQSKPPARGAKPLSSFFTPRKPAVK
TEVKQEESDTPRKEETKGAPDPTNYNPSKSNYHPIEDACWKHGQKVPFLAVARTFEKIEE
VSARLKMVETLSNLLRSVVALSPTDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQA
TGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTVSGVFTKFCDIARLTGSASMS
KKMDIIKGLFVACRYSEARFIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPTAVV
DAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLESLPEHCKLSPGVPLK
PMLAHPTRGVREVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNSGKYPDI
ISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFD
LIYLNGESLARQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEG
LMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLA
AYDEESEELQAICKLGTGFSDEELEEHHQSMQALLLPTPRPYVRIDGAVAPDHWLDPSVV
WEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVREDKQPEQATTSDQVASLYRKQS
QIQNQQSSDLDSDVEDY
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgggaccacagctgaagctgccaggtggtggcatatatcttctttattctaaaactgtt
ctttctgtctgttttcagaagcctgtgtcagactccaaacagagctctcctcccagccct
gactcctgtcctgagaacagcagcccctccatggacatctccccatcaggattcccaaag
cgccgaactgcacggaagcagctcccaaaacggacaattcaagacactcttgaggagcac
aatgaagacaaagacaaagcagctaagaaaaggaaaaaagaagatacacagaccccaaca
gaaagcctcacagaggctgaagaagtaaaacagaaggaagaacaggtggaggaccagccc
acagtaccccctgagcccacagagtcccctgagtcagtaaccctcacaaagacagagaac
attccaatgtgtaaggcaggtgtgaaacagaagcctcaggaagaagaacagagcaagcct
cctgccaggggtgccaagccactgagcagtttcttcacaccccgaaaaccagcagtgaaa
actgaagtcaaacaagaagagtcagacactccaaggaaggaagagaccaagggagccccg
gatccaaccaattataatccttccaagagtaactaccatcccattgaagatgcctgctgg
aaacatggccaaaaggttccttttcttgctgtggcccggacatttgagaagattgaggag
gtgtctgctcggcttaagatggtggagacactgagcaacctgctgcgctccgtggtggcc
ctgtccccaacagacctgctccctgttctctatctcagcctcaaccgccttgggccgcct
cagcagggtctagaactgggtgttggtgatggtgtcctcctcaaggcagttgcccaggcc
acaggtcgtcagctggagtccatccgggctgaggtagctgagaagggggatgtggggcta
gtggcggagaacagccgaagcactcagaggctcatgctgcctccacctccacttactgtt
tctggagtctttaccaaattctgtgacattgcccggctcactggcagtgcgtcaatgtct
aagaaaatggacattatcaagggcctttttgttgcctgccgctactcagaagcccggttt
attgccaggtccctaagtgggcggctgcgccttgggctggctgagcagtcagtactggct
gctcttgcccaggctgtgagcctcacaccccctggccaagaatttcccacagccgtggtg
gatgctgggaagggcaagacagcagaggccagaaagatgtggttggaagaacaaggcatg
atcttgaagcaaaccttctgtgaggtgcctgatctggatcgcatcatccctgtgctgctg
gaacatggcttggaaagtctcccagagcactgcaagctgagcccaggggttcctcttaaa
ccaatgctggcccatcccactcggggtgtccgtgaggtcctgaaacgctttgaggaggtc
gacttcacctgcgagtataaatacgatgggcagcgggcacagatacatgttctggaaggt
ggagaagtgaagatcttcagcaggaaccaggaagacaactcaggaaagtatcctgacatc
atcagccgcatccccaagattaaacacccctcagtcacatctttcattctggacactgag
gctgtggcctgggaccgggaaaagaagcagatccagccattccaagtgctcaccacacgc
aagcgcaaggaggttgatgcatcggagatacaggtacaagtgtgtctgtatgcttttgac
ctcatctacctcaacggagagtccctggctcgccagcccctgtctcgacgccggcagcta
ctccgtgagaactttgtggagacagagggtgagtttgtctttgccacctccttggacacc
aaggacatcgagcagattgccgagttcttagagcagtcagtgaaggactcctgtgagggc
ctgatggtgaagaccctggatgttgatgctacctatgagatcgccaagaggtcacacaac
tggctcaagctgaagaaggactaccttgaaggtgtgggcgacactctagaccttgtggtg
attggtgcctacctgggccgggggaagcgggctggccggtatgggggcttcctgttggct
gcctacgatgaggagagtgaagagctgcaggccatatgcaagctgggaaccggattcagc
gacgaggagctggaagaacatcatcagagcatgcaggcccttttattgcctaccccacgc
ccctatgtgaggattgatggggcagtggccccagaccactggctagacccgagtgttgtg
tgggaggtgaaatgtgctgatctctccctgtctcccatctaccctgctgctcggggcctg
gtggacaaagaaaaagggatctcccttcgtttccctcggttcattcgtgtccgtgaggat
aagcagccagagcaggccactaccagtgaccaggtggcctctttgtaccggaagcagagt
cagattcagaaccagcaaagctcagacttggactctgatgttgaagattactaa

DBGET integrated database retrieval system