KEGG   Rattus norvegicus (rat): 100912013
Entry
100912013         CDS       T01003                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4B-like
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100912013
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    100912013
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100912013
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100912013
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 PIF1 NB-ARC AAA_30
Other DBs
NCBI-GeneID: 100912013
NCBI-ProteinID: XP_003748802
RGD: 6489396
Ensembl: ENSRNOG00000015527
LinkDB
Position
1q21
AA seq 918 aa
MASLFSDFGFMWYWKELNKVEFMKFKELLILEILQMGLKQISWTEVKNASREDLAILLVK
YCEGKQAWDTTFKVLQKISRHDLTERATGEIAAHANIYRAHLKKKLTRDCSRKFSISIQN
FFQDEYDHLENLLIPKVTEEKPQLVFLKGIAGIGKTILLKNLMIVWSEGLVFQNKFSYIF
YFCCQDVKQLKTTSLTELISREWPSSSAPIEEILSQPEKLLFIIDSLEGMEWDFTKQESE
LCDNCLEKQPVNVLLSSLLKKKILPESSLLISATFETFEELKDWIEYTNVRTITGFKESN
IKMYFHSLFQDRNRALEAFSFVRENEQLFTLCQAPVICCMVATCLKNEIEKGKDPVSICR
RTTSLYTTHIFNLFIPPNVQYPSKKSQDQLQGLCFLAVEGMWTDISVFSEETLRRNGILD
SDIPTLLDIGILEQSRESQNSYIFFHPSVQEFCAAMFYLLQTHMNHPSPDVLHVEKLLFS
FLKEVNTQWIFLGRFIFGLLNELEHEKLEAFFGYQLSQQLKQELFEWLELLLDPEVKVNT
MKFFYCLFEMEEEVFVQSAMNCREEIDVVAKDYYDFIVAAYCLNHGSALRDLSISTQNVL
NEKLNQRYMENLLMLWHNICSVFARNKDIHILQMKDTIFNEPVFQILYNYLKNSSCILEV
LVANDVSFLCDKYLFFDLIQSYNLELLDLSGTFLSHSDVVILCNILNKAEYKIQELELAN
CSLSEQSWKYISDVLCQNKTLRHLDISSNDLKDEGLKVLCKALTLPDSVLLTLSVKACFI
TTVGCQYLAEVLRNNHKLMFLTLSENKLEDSGVKLLCDAIKHPRCQLAQLDLEACELTGA
CCEDLASTFTQCKTLGWINLVKNALDFNGLVVLCKALKQKTSNLKELRLRITDFDNKSQT
FLLSEEKGNKFLNIENDE
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggcatctctcttttctgattttggctttatgtggtactggaaagagctaaacaaggtg
gaattcatgaagtttaaggaattactcatacttgagattctgcaaatggggctaaaacag
atttcttggactgaagtaaagaatgcatctcgggaagatcttgccatcttactggtgaaa
tattgtgaggggaagcaagcctgggacacaaccttcaaagttctccagaaaatcagtaga
catgatctcactgagagggcaacaggggagattgctgcacacgcaaatatatatcgagct
catttaaagaagaagctgacccgtgattgttctagaaagttcagcattagtattcagaat
ttcttccaggatgaatatgatcatcttgagaaccttctcataccaaaggtaactgaagaa
aagccacaactggtgttcctgaaaggtatagctggaattggcaagactattctgttgaaa
aatttaatgattgtctggtcagaaggccttgtgtttcagaacaaattctcctatatcttc
tacttctgttgtcaagatgtgaagcaattgaagaccacaagcctgactgaactgatctcc
agagagtggcccagttcctcagctcccatagaggagatcctatcccaacctgaaaagctc
ttatttatcattgacagtttagaagggatggaatgggattttaccaaacaggaatcagaa
ctgtgtgacaattgcttagagaagcagccagtgaatgtattgctgagcagtttgctcaag
aagaagatactccctgaatcatctcttcttatctcagctacttttgagacttttgaggaa
ttgaaggactggattgagtacacaaatgtgagaacaataactggattcaaggaaagcaat
attaagatgtatttccatagcttgttccaagataggaacagagccttggaggccttcagt
tttgtaagagaaaatgagcagctgttcactttatgtcaggcccctgtgatctgctgcatg
gtagctacttgtcttaagaatgagatagagaaggggaaagatccagtctctatctgtcga
cgtaccacctctctgtacaccactcacatcttcaatttgttcattcctccaaatgtccaa
tacccaagtaagaaaagccaagaccaactacagggcttgtgttttctagcagtggagggc
atgtggactgacatatctgtgtttagtgaggagactctgaggagaaatggaatcctggac
tctgacatccctacattgttggacattggaattcttgaacagagcagggagtctcaaaat
tcttacatattcttccacccgtctgtccaggagttctgtgctgccatgttttatctgcta
cagacccacatgaaccaccctagtccggatgttctccatgtagaaaaactattgttttct
tttctaaaggaggtcaatacacagtggatttttttgggtcgtttcatatttggccttttg
aatgaattggaacatgaaaaactggaagcattttttggctaccagttgtctcagcaacta
aaacaagaattgtttgagtggctggaacttctgttggaccctgaagttaaagtaaataca
atgaagttcttttactgtctgtttgagatggaagaggaagtcttcgtacagtcagcaatg
aactgtagggaagagattgacgttgtggctaaggattattatgattttatcgttgctgcc
tactgcttaaaccatggttctgcactgagagacttatctatttcaacccaaaatgtccta
aatgaaaagctgaatcagagatatatggaaaatctactcatgctttggcataatatatgc
tctgtgtttgcaaggaataaggacattcacatcctccaaatgaaagacactattttcaat
gagccagtttttcaaatcttatataattatctaaagaactccagctgtatccttgaagta
cttgtggcaaatgatgtgtcctttttatgcgataagtacctattttttgatttgattcaa
agctacaatttggaactcttggacctcagcggcacattcctctcccatagtgatgtggta
atattgtgtaatatcttgaacaaggcagagtacaaaatacaagaactcgagttagccaac
tgttccctcagtgagcaatcttggaaatacatttctgatgttctttgtcagaacaaaacc
ctgagacacctagacatcagctccaatgacctgaaggatgaaggactgaaagttctctgt
aaggctctcactctcccagacagtgtactgttaacactaagtgtgaaagcttgtttcatc
accactgtaggctgccagtacctggctgaagtcctcaggaacaaccataaactgatgttc
ctaacactttcagagaataagctagaagactctggtgtgaagctcctgtgtgatgctata
aaacatcccagatgccaattagctcaactcgacttggaagcctgtgaacttactggtgcc
tgttgtgaggatcttgcttctacttttacccagtgtaaaaccttgggttggatcaatctg
gtgaagaacgctttggacttcaatggattggttgtgctatgcaaggctctgaaacagaaa
acctctaacctgaaagaactaagactgcgaataactgactttgataacaaatcccagaca
tttctactttctgaggaaaagggaaataaattcttgaatatcgaaaatgatgagtaa

DBGET integrated database retrieval system