KEGG   Rattus norvegicus (rat): 102238592
Entry
102238592         CDS       T01003                                 

Gene name
Ak6
Definition
(RefSeq) adenylate kinase isoenzyme 6
  KO
K18532  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno03008  Ribosome biogenesis in eukaryotes
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102238592 (Ak6)
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102238592 (Ak6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    102238592 (Ak6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     102238592 (Ak6)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    102238592 (Ak6)
SSDB
Motif
Pfam: AAA_18 AAA_17 AAA_28 AAA SKI AAA_16 ADK NTPase_1 AAA_33 AAA_22 AAA_5 Cytidylate_kin2 Cytidylate_kin RuvB_N AAA_24 RNA_helicase KTI12 AAA_3 IstB_IS21 ATPase TsaE NACHT PduV-EutP AAA_14 Mg_chelatase
Other DBs
NCBI-GeneID: 102238592
NCBI-ProteinID: NP_001012481
RGD: 7387335
Ensembl: ENSRNOG00000039848
Vega: OTTRNOG00000000241
UniProt: Q5EB68
LinkDB
Position
2
AA seq 172 aa
MKLPNILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGHLYDGYDEEYGCPILDEDR
VVDELEPQMTEGGVIVDYHGCDFFPERWFHIVFVLRTDNGILYKRLETRGYHEKKLQDNI
QCEIFQVLYEEAMASYKEEIVHQLPSNEPEQLEDNINQISKWIEQWVKDHNP
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaagcttccgaacatcctgctcaccggtacaccaggggttggaaaaaccacactaggc
aaagaacttgcatcaagatcaggcctgaagtacgttaatgtgggagatctagctcgggaa
gggcacttgtacgatggctatgatgaggagtatggctgccccatcctagatgaggacagg
gttgtggacgagttagagcctcagatgacagagggcggcgtgatcgttgattaccacggt
tgtgatttctttcctgaacgctggttccatatagtgttcgtgttgaggacagacaatggt
atattgtacaaacgacttgaaacaaggggttatcacgagaagaaactacaagataatatt
cagtgtgagatttttcaagttctctatgaagaagccatggcatcttacaaagaagaaatt
gtgcatcagctgcccagtaacgagccagagcagctagaggacaatatcaaccaaatctca
aagtggatcgagcagtgggtgaaagaccacaacccttaa

DBGET integrated database retrieval system