KEGG   Rattus norvegicus (rat): 102547219
Entry
102547219         CDS       T01003                                 

Definition
(RefSeq) uncharacterized LOC102547219
  KO
K23663  modulator of smoothened protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102547219
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB DUF998
Other DBs
NCBI-GeneID: 102547219
NCBI-ProteinID: XP_006223602
RGD: 7606925
LinkDB
Position
1q36
AA seq 164 aa
LTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPRLPP
EWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIGFYI
NEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 495 nt   +upstreamnt  +downstreamnt
ctgaccatcatctcaggatgtctctttctggccgccgatatcttcgccatcgccagcatc
gccaacccggactggatcaacaccggggagtcggcgggagcacttactgtgggccttgtg
cggcagtgtcagacaatccatggacgagaccggacctgcatcccccctcggcttccccca
gagtgggtcaccaccctgttctttatcatcatggggatcatttccttgactgtcacatgt
ggcttgctggtggcttcccactggcgaagagaagctacaaaatatgctcgatggatagca
ttcactggaatgatccttttctgtatggctgccctaatatttccaataggattttacatc
aatgaagtcggaggtcaaccttataagttacccaacaacacagtagttgggtcatcatat
gtactttttgtcttatcgattttcttcacaatagtaggacttctgtttgctggcaaagtc
tgtttaccaggctga

DBGET integrated database retrieval system