KEGG   Rattus norvegicus (rat): 103689944Help
Entry
103689944         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 10C1-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 103689944
NCBI-ProteinID: XP_006255920
RGD: 9269809
LinkDB All DBs
Position
20p12
AA seq 228 aa AA seqDB search
MFLVSLTGNTLIALAVCTSPSLTECCLLAAMAFDRCMAICSPLHYATRMSREVCAHLAIV
SWGMGCIVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQNEAAIFVAAILCI
SSPFLLILYSYVRILVAVLVMPSPEGRHKALSTCSSHLLVVTLFYGSASFTYLRPKSSHS
PGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRRTLDLRKIMSINR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttcttagtatcactaacaggaaatactctcatagcccttgctgtttgtaccagtcca
tctctaactgagtgctgcctattggcagccatggcctttgaccgctgcatggccatatgc
tccccactccactatgcaacccgaatgagtcgtgaggtatgtgcccatttggcaattgtt
tcatggggaatgggatgcatagtaggtctgggacagaccaattttattttctccttgaac
ttctgtggaccctgtgagatagaccacttcttctgtgaccttccacctctcctggcactt
gcctgtggtgatacatcccaaaacgaggctgccatctttgtggcagcaatcctctgtata
tctagtccatttttgctgatcctttattcttatgtcagaattctcgttgcagtgctggtg
atgccttcacctgaggggcgccataaagctctttccacctgttcctcacacctacttgta
gtcacactcttttatggctctgcgtcctttacctatttgaggcccaagtctagccactca
ccaggaatggacaaactcttggccctcttctacacagcagtgacatccatgctgaaccct
atcatctacagtctaaggaacaaggaagtcaaggcagcactgagaagaactttggacctg
agaaaaataatgtcaataaataggtaa

DBGET integrated database retrieval system