KEGG   Rattus norvegicus (rat): 103690044Help
Entry
103690044         CDS       T01003                                 

Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103690044
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103690044
   00982 Drug metabolism - cytochrome P450
    103690044
   00983 Drug metabolism - other enzymes
    103690044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103690044
   05204 Chemical carcinogenesis
    103690044
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103690044
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103690044
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103690044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    103690044
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103690044
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   103690044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 103690044
NCBI-ProteinID: XP_008758721
RGD: 9449876
Ensembl: ENSRNOG00000049964
Vega: OTTRNOG00000000842
UniProt: Q6AXV9 B6DYQ6
LinkDB All DBs
Position
1q55
AA seq 248 aa AA seqDB search
MSGDLTRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKP
DWYYTKHPFGQVPVLENSQCQLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELF
CKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWISSMKQDPAVCALHIDKNIFLGFLNLYFQNNPCAFDF
GLCGPIVR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatttgacaagatgcttggggaaaggaagctgtcccccagggccggtccct
gagggtgtgatccgaatctacagcatgaggttctgcccctactcgcacaggacacgcctg
gtcctcaaggccaaaagcatcaggcatgaaatcatcaacattaacctgaaaaacaagcct
gattggtactatacaaaacacccttttggccaggttcctgtcctggagaacagccaatgt
cagctgatctatgaatccgtcattgcgtgtgagtacctggatgacgtcttcccaggaagg
aagctgtttccatacgacccatatgaacgagctcgccagaagatgttattggagctattc
tgtaaggtcccacagttaagcaaggaatgtctggtagcgctgagatgtgggagagactgt
acggatctgaaggttgccctgcgtcaggagttgtgcaatctggaagagattcttgaatat
cagaacactaccttcttcggtggagactctatatccatgattgattacctcgtctggccc
tggtttgagcgactggatgtatatggactggctgactgtgtgaatcacaccccaatgctg
cggctctggatatcctccatgaagcaggaccccgcagtgtgcgctctgcacattgataag
aacattttcctgggcttcttgaatctctatttccaaaacaacccttgtgcctttgatttt
gggctgtgtggcccaatcgtacggtaa

DBGET integrated database retrieval system