KEGG   Rattus norvegicus (rat): 103690059Help
Entry
103690059         CDS       T01003                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103690059
   00500 Starch and sucrose metabolism
    103690059
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103690059
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103690059
    3.2.1.20  alpha-glucosidase
     103690059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103690059
NCBI-ProteinID: XP_008761089
RGD: 9369725
LinkDB All DBs
Position
4q23
AA seq 3560 aa AA seqDB search
MARRRFKKFSTLELVLIVLLLILFIVAVVLIVLLANSTEPNAVDAETTGTPDTTLTRTTL
NFPECPVLSEAERINCIPDQSSNKDTCDQRGCCWDPQGSISVPCYFSRNHGYKMESDLAN
TTAGFTAALKNLASAPVFGNGIENILLTAEYQTSNRFHFKLTDQTKERYEVPHEHVKPFS
GNAASSLNYNVEVFKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQLSTHLPSANVYGL
GEHVHQQYRHDMNWKTWPMFARDTTPNEDGNNLYGVQTFFLCLEDNSGLSFGVFLMNSNA
MEVTLQPTPAITYRITGGILDFYVFLGNTPEQVVQEYLELIGRPTLPSYWTLGFQLSRYD
YGSLDKMKIVVERNRAAQLPYDVQHADIDYMDQRKDFTYDPVNFKGFPEFVKELHNNGQK
LVIILDPAISNNSLSSNPYGPYDRGSAMKVWVNSSDGNALIGKVWPGTTVFPDYTSPNCA
VWWKKEIELFHNEVEFDGIWIDMNEVSNFVDGSVSGCSQNNLNYPPFTPKVLDGNLFSKT
LCMDAVQHWGKQYDVHNLYGYSMAIATEEAVKTVFPDKRSFILTRSTFAGSGKFAAHWLG
DNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAMNTYEELCRRWMQLGAFYPFSRNHN
GQGYKDQDPASFGEDSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYE
DSNTWDIDRQFLWGPGLLITPVLDQGAEKVKAYVPDATWYDYETGEQLAWRKQSVEMELP
EDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIIALDKNKEAKGELFWDDGQTKDTVAK
NLYLFTEFSATQVATITNIHLMLGEAYTVEWDIFTRDEEKIDCYPDEHGVSEANCIARGC
IWEVSNTPGVPHCYFANELYSVSNIQYNSHGATADIFLKASTYSNAFPSTPVNQLQLKVA
YHKDQMLQFKIYDPNRSRYEVPVPLNIPSAPSSTPEGRLYDVFIKENPFGIQIRRKSTGT
VMWTSQLLGFTFNDMFIRISTACSHIHLWLLGKLSTTTFKIDMNWQTWGHVFPVDEPPGY
KKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTVGGILDFYVFLGPTP
EIVTEQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKRIPYDVQYSDIDY
MERQLDFKLNPKFSGFPDLINRMKDNGMRVILILDPAISGNETEPYPAFTRGVENDVFIS
YPNNGGIVWGKVWPDYPNITVDPSLDWDSQVQQYRAYVAFPDFFRDSTALWWKNEIKELH
SNSQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCTDTTLNRPPYMPHLEARDRGLSSKTL
CMESEHILPDGSRVRHYDVHSLYGWSQTRPTYEAMQEVTGERGIVITRSTFPSSGRWGGH
WLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSR
NHNTIGTKRQDPVSWNETFEDISRSVLETRYTLLPYLYTLMYKAHKEGSTVVRPLLHEFL
ADRETWNVDKQFLLGPAFLVSPVLELNARNVTAYFPKAQWYDYYTGADINSTGEWRTLPA
PLEHINLHVRGGYILPWQQPALNTNLSRKKPLGLLIALNENKEARGELFWDDGQSKDTVA
KNIYLFSEFSVTQNRLDVTISSPNYKDPNNLEFQEIKIFGTQEIRNVKVKQNGVLLQMSP
QVNYNSNLKVATITNIHLVLGEAYTVEWDIYSKDVERIDCYPDEHGVSEANCTARGCIWE
VSNTPGVPHCYFANELYSVSNIQYDSHGATADISLKASPYSNAFPSTPVNQLQLKVTYHK
DQMLQFKIYDPNRSRYEVPVPLNIPSAPSSTPEGRLYDVFIKENPFGIQIRRNSTGTVIW
DSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMNWHTWGMFSRDEPPGYKKNS
YGVHPYYMGLEEDGNAHGILLLNSNAMDVTFQPMPALTYRTTGGILDFYVFLGPTPEIVT
QQYTELIGRPVMVPYWSLGFQLCRYGYENDAEIANLYDEMVAKQIPYDVQYSDIDYMERQ
LDFKLNPKFSGFPDLINRMKDNGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNN
GDIVWGKVWPDYPNIVVNSSLDWDSQVEQYRAYVAFPDFFRNSTALWWKKEIEELYRNTQ
EPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDTTLNRPPYMPYLEARDRGLSSKTLCMES
EHILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGERGIVITRSSFPSSGRWGGHWLGD
NTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNT
IGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRE
TWSIDKQFLLGPAFLVSPVLEPDARNIRSYFPRALWYDYYTGENINSTGEWRTLSAPLEH
INLHVRGGYILPWQRPALNTHLSRKNPLGLIIALDENKEARGELFWDDGQSKDLTTNNIL
CKFSVTQNRLDVSTSKSTYTDPDNLTFQEIKIFGTQALYNVTVKHNGMVNQMSPQVSYDP
NMKVALITGIQLLLNESYTVEWDGSIRDGEKMDCYPDQHGASEANCTARGCVWEVSNSPG
VPFCYFVNELYSVSNVQYDSHGASANISLKASPYSNAFPSTPVNELQLKVTYHKDEMLQF
KIYDPNHSRYEVPVPLNIPSSPSSTPDNRSYDVFIKENPFGIEIRRKGTGSVIWDSRLLG
FTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMNWHTWGMFSRDEPPGYKKNSYGVHPY
YMGLEEDGNAHGILLMNSNAMDVTLQPMPALTYRTTGGVLDFFVFLGPTPELVTQQYTEL
IGRPVMVPYWSLGFQLCRYGYENDTEIANLYDDMVAKKIPYDVQYSDIDYMERQLDFKLN
PKFSGFPDLINRMKHDGMRVILILDPAISGNETEPYPAFTKGVENDVFIRYPNNGDIVWG
KVWPDYPNITVDPSLDWDSQVEQYRAYVAFPDFFRNSTALWWKDEIKELHSNTQDPAKSL
KFDGLWIDMNEPSSFVNGAVPSGCSDATLNRPPYMPHLEARDRGLSSKTLCMESEHILPD
GSRVRHYDVHSLYGWSQTRPTYEAVQEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWD
QLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQ
DPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDK
QFLLGPAFLVSPVLEPNARTVAAYFPKARWYDYYTGVDINARGEWKTLQAPLEYINLHVR
GGYILPWQEPAMNTQLSRKKSMGLKAALNDEGLAEGWLFWDDGKSINITNQYYLARFSVS
QNTLQTHEMFNNYITGTVPLYLGYIEIWGLSSPSITSVRISGKNLNEEVLADYNTTTQIL
RVNVTDKNISLHAFQSLTWS
NT seq 10683 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacgaaggtttaagaagttcagcaccctggagcttgtgctcattgttctgctg
cttatactgttcatcgtcgcggtggttctaattgtgctcttagccaactccacggaacca
aatgctgtggacgctgaaacaactggcactccagacactacactcaccaggaccactctt
aactttcccgaatgcccagtgctaagtgaggcggaacggataaattgcatccctgaccag
tcatctaataaggatacatgtgaccagcgtggctgctgctgggatcctcagggatccatc
agtgttccttgctacttttccagaaatcatggctacaaaatggagagtgaccttgcaaac
acaactgcaggattcacagctgcactgaaaaacttagcttctgcacctgtgtttggaaat
ggcatcgaaaacatcctgcttacagcagagtaccagacatcaaatcgcttccattttaag
ttgactgaccaaaccaaggagaggtatgaggtgccccacgagcatgtgaaacccttcagt
ggaaatgctgcttcttccttgaactacaatgttgaggtcttcaaggagccatttagcatc
aaagtcaccagaaaaagcaataaccgtgtgctgtttgactcaagtattgggcccctcctc
ttctctgaccagttcctgcagctctccacccacctgccaagtgctaatgtgtatggtctg
ggtgagcatgtgcaccagcagtaccggcatgatatgaattggaagacctggcctatgttt
gccagagatacaaccccgaatgaggacggaaataacttgtatggtgtgcaaacattcttc
ctgtgccttgaagataatagtggattgtcctttggggtgttcctgatgaacagcaatgcc
atggaggttacccttcagcctaccccagcaatcacataccgcatcactgggggaattctg
gacttctatgtgtttttggggaacacacctgagcaagttgttcaagaatacctagagctc
attgggcggccaactctgccttcatactggacacttgggtttcagctcagccggtatgat
tatggaagcctagataaaatgaaaatagttgtggagagaaaccgtgcagcacaactccct
tatgatgttcagcatgctgacattgattatatggatcagagaaaggacttcacttatgac
ccagtgaactttaaaggcttcccagagtttgtcaaggagctacacaataatggacagaag
cttgttatcattttggatccagccatttccaacaactctctctcaagtaatccctatggc
ccatatgataggggttcagcaatgaaagtctgggtgaatagttctgatggcaatgcactc
attggaaaggtctggcctggaacaactgtgtttcctgattacaccagtcccaactgtgct
gtttggtggaaaaaagaaattgagcttttccacaatgaagtggagtttgatggaatttgg
attgatatgaatgaagtctccaactttgttgatggttcagtttctggatgttcccaaaac
aacttgaattatcccccattcaccccaaaggtcctggatgggaacttgttctctaagact
ctctgcatggatgcagttcagcactggggaaagcagtatgatgtccacaatctgtacggc
tattccatggccattgccactgaagaagccgtgaagaccgtgttcccagacaagagaagc
ttcattctaacacgttctacctttgccggttctggcaaatttgcagcccactggttagga
gataacactgccacctggaaggaccttcagtggtccatcccaggcatgcttgagttcaac
cttttcggtatcccaatggtaggggccgatatatgtggctttgccatgaacacatatgag
gagttgtgcaggcgctggatgcagctgggggcattttatccattttcccggaatcacaat
gggcaaggttacaaggaccaggatcctgcttctttcggagaagactccttgctgttgaat
tcatctaggcactaccttaacatccgctacacgttgctgccttacctctacactcttttc
tacagagcacacagccggggagacactgtagctaggcctcttctgcatgagttctatgaa
gacagcaatacttgggacatagacagacaatttctgtggggaccaggtctcctcatcact
cctgttctggatcagggtgcagagaaagtgaaagcgtatgtgccggatgccacctggtat
gactatgagaccggagagcaattggcatggagaaagcaaagcgttgagatggaacttcct
gaagacaagattggacttcaccttcgagggggctacatcttccccacacagcagccagcc
acaaccacagaagccagtcggaagaatcctcttggtcttatcattgccctggataagaac
aaggaagcaaaaggagagctgttctgggatgatgggcagacaaaggacactgtggccaaa
aacctttaccttttcaccgaattctccgccactcaagttgctaccatcacaaatatccat
ctcatgctgggagaagcatatacagtcgagtgggacatcttcacgagggatgaggaaaag
atagattgttatccagatgaacatggtgtttctgaggcaaactgcattgcccgtggctgc
atctgggaggtttccaacactcctggcgtccctcattgctactttgctaatgaactgtac
tcagtcagcaatattcagtacaactcccatggggccacagctgacattttcttgaaggct
tctacttatagcaatgccttcccctctacacccgtgaatcaactgcaactgaaggtggcc
taccacaaggaccaaatgctgcagtttaagatctatgatcccaaccgcagtcgttatgaa
gttccagtccctctgaacatccccagtgctccgtcgagcacccctgaaggccgtctgtat
gatgtcttcatcaaggagaatccatttgggattcaaattcgccgaaagagcacaggcact
gtaatgtggacttctcagctccttggcttcaccttcaatgacatgttcatccgcatctcc
accgcctgctcccacatacatctatggcttttggggaaactgagcaccacaaccttcaag
atagacatgaactggcaaacatggggccatgttttcccagtggatgagcccccagggtac
aaaaagaattcctatggtgtccacccttactacatggggctggaggaggatggcaatgcc
catggagtcctcttgatgaacagcaatgccatggatgtaaccttccagcccatgcctgcc
ctgacataccgaaccgtagggggcattctggacttttatgtgttcttgggcccaactcca
gagattgttactgaacaatacacagagttgattggtcggcctgtgatggtaccttattgg
tccctgggattccagctgtgtcgctatggatatgagaatgatacggagattgccaaccta
tatgatgaaatggtggctaagcggatcccatatgatgtgcagtactcagacattgactac
atggagaggcagctggacttcaagctcaaccctaagttctctgggtttccagacctgatc
aatcgcatgaaggacaatgggatgcgggtcatcctcattctggatccagctatttctggc
aatgagacagagccctatcctgccttcaccaggggagtggagaatgacgtcttcatcagc
tatcccaataatggaggcattgtttggggaaaggtctggcctgattaccctaatatcact
gtggacccatctctagactgggacagtcaagtgcagcaataccgagcttatgtggccttc
ccagactttttccgtgattcaactgccctctggtggaagaatgagattaaagaactccac
agcaactcacaggatcctgcaaagagcttgaagtttgatggcctgtggattgacatgaat
gaaccttccagctttgtgaatggggcagttccttccggctgcactgacactactctgaac
cgtcctccctacatgccacatttggaagccagggacaggggcctgagcagcaagaccctg
tgcatggagagcgagcacatccttccagatggctcccgggtgcggcactatgatgtacac
agcctgtatgggtggtcccagaccagacccacctacgaagctatgcaggaggtgacagga
gagagagggattgtcatcacccgctccacattcccctcttctggacgctggggaggacac
tggctgggagacaacacagctgcctgggaccagctggggaaatccatcattggcatgatg
gatttcagcctctttggcatatcctatactgggtcagacatctgtgggttctttcaagat
gccgaatatgagatgtgtgttcgctggatgcagctgggcgccttttaccccttctccagg
aaccacaacaccatcgggaccaagaggcaagaccctgtatcctggaatgaaacctttgag
gacatttccagaagtgtgctggagaccagatacaccctgttgccatatctctacaccttg
atgtacaaagcccataaggagggcagcacagttgtgcggcctcttctgcatgagtttctg
gcagaccgggagacctggaacgtagacaaacagttcctgctgggtccagccttcctagtc
agccctgtccttgaacttaatgccagaaatgtcactgcatatttccctaaagcccagtgg
tatgattattacacgggtgcagatattaattcaacaggagagtggaggaccttgccagcc
cctcttgagcacattaatcttcatgtccgagggggttacatcttgccatggcaacaacct
gccctgaacaccaacttaagtcggaagaaacctcttggtctcctcattgctctgaacgag
aataaagaagcaagaggagagctgttctgggatgatgggcagtcaaaggacactgtggcc
aaaaacatttaccttttcagtgaattttctgttacccaaaaccgtttggatgtaacaatt
tcaagtccaaactacaaggatcccaataacctggaattccaggaaattaaaatctttggg
acacaggaaatccgcaatgttaaagtgaaacagaatggggttctccttcaaatgtctcct
caagtcaattacaattcaaacctgaaggttgctaccatcacaaatatccatcttgtgctg
ggagaagcatatacagttgagtgggacatctactcaaaggacgtggaaaggatagattgc
tatccagatgagcatggtgtttctgaggcaaactgcactgctcgtggctgcatctgggag
gtttccaacactcctggggtccctcattgctactttgctaatgagctgtactcagtcagc
aatattcagtatgactcccatggggccacagctgacatttccttgaaggcttcaccttat
agcaatgccttcccctctacacccgtgaatcaactgcaactgaaagtgacctaccacaag
gaccaaatgctgcagtttaagatctatgatcccaaccgcagtcgttatgaagttccagtc
cctctgaacatccccagtgctccatcgagcacccctgaaggccgtctgtatgatgtcttc
atcaaggagaatccatttgggattcaaattcgccgaaatagcacaggcactgtaatctgg
gactctcagctccttggcttcaccttcaatgacatgttcatccgcatctccacccgcctg
ccctccacatacatctatggatttggggaaactgagcacacaaccttcaagatagacatg
aattggcatacatggggcatgttttccagggatgaacctccagggtacaagaagaattcc
tatggtgtccacccttactacatggggctggaggaggacggcaatgcccatggaatcctc
ctgttgaacagcaatgccatggatgtaaccttccagcctatgcctgccctgacataccga
accacagggggcattctagacttctatgtgttcttgggcccaactccagagattgttact
cagcagtatacagagttgattggtcggcctgtgatggtaccttactggtccctgggattc
cagctgtgtcgctatggatatgagaatgatgctgagatcgccaacttgtatgatgagatg
gtggctaagcagatcccctatgatgtgcagtactcagacattgactacatggagaggcag
ctggacttcaagctcaaccctaagttctctgggtttccagacctgatcaatcgcatgaag
gacaatgggatgcgggtcatcctcattctggacccagccatttctggcaatgagacagag
ccctatcctgccttcaccaggggagtggagaatgacgtcttcatcagatatcccaataat
ggagacattgtctggggaaaggtctggcctgattaccctaatattgttgtgaactcctct
ctggactgggacagtcaagtggagcaatatcgagcttatgtggccttcccagactttttc
cggaattcaactgccctctggtggaagaaggagattgaagaactctacaggaacacacag
gaaccggcaaaaagcttgaagtttgatggcctgtggattgatatgaatgaaccttccagc
tttgtgaatggggcagttccttccggctgcagtgacactactctgaaccgtcctccctac
atgccatatttggaagccagggacaggggcctgagcagcaagaccctgtgcatggagagc
gagcacatccttccagatggctcccgggtgcggcactatgatgtacacagcctgtatggg
tggtcccagaccagacccacctacgaagcagtgcaggaggtgacaggagagagagggatt
gtcatcacccgctcctcattcccctcttctggacgctggggaggacactggctgggagac
aacacagctgcctgggaccagctggggaaatccatcattggcatgatggatttcagcctc
tttggcatatcctatactgggtcagacatctgtgggttctttcaagatgccgaatatgag
atgtgtgttcgctggatgcagctgggcgccttttaccccttctccaggaaccacaatacc
atcggaaccaggagacaagacccagtatcctggaataaaacctttgaggatatttccaga
agtgtgctggagaccagatacaccctgttgccatatctctacaccttgatgtacaaggcc
cacacagagggcagcacagtcgtgcggcctcttctccatgaatttgtgtcagaccgggag
acctggagtatagacaaacagttcctgctgggcccagctttcctagtcagccctgtgcta
gaacctgatgcccgaaacatcagatcatatttccccagagccctctggtatgactactac
acgggtgaaaatatcaattcaacaggagagtggaggactttatcagcccctcttgagcat
atcaatcttcatgtccgtgggggctacatcctgccctggcaacgacctgccctgaacact
cacttaagtcggaagaatcctcttggtcttatcattgctctggatgagaacaaagaagca
aggggagagctattctgggatgatgggcagtcgaaggatctcacaaccaataacattctg
tgtaaattttcagtcactcaaaaccgcttggatgtgagcacttcaaaatcaacctacacg
gatcctgataacttaacatttcaggagattaaaatttttggaacacaggcactttacaat
gttacagtgaaacacaatggtatggtaaatcagatgtctcctcaagtcagttatgatcca
aacatgaaggttgcacttattacaggcatccaacttctcctgaatgaatcctacacagtg
gagtgggatggcagcatcagggatggagaaaagatggattgttatccggatcaacatggg
gcttctgaagcaaactgcactgcccgaggctgtgtctgggaggtttccaactctcctggg
gtccccttttgctactttgtcaatgagctgtactcagtcagcaatgttcaatatgactcc
catggggcttcagccaacatctccttgaaggcttcaccttatagcaatgccttcccctct
acacccgtgaatgaactgcagctgaaagtgacctatcacaaggacgaaatgcttcagttt
aagatctatgatccaaaccacagtcggtatgaagtcccagtccctctgaacatccccagc
tctccatccagtacccctgacaaccgctcgtatgatgtgttcatcaaggagaacccattt
gggattgaaattcgtcggaagggtacaggctctgtcatctgggactctcggctccttggc
ttcaccttcaatgacatgttcattcgcatctccacccgcctgccctccacatacatctat
ggctttggggaaactgagcacacaaccttcaagatagacatgaactggcatacatggggc
atgttttccagggatgagcccccagggtacaagaagaattcctatggtgtccacccttac
tacatggggctggaggaggacggcaatgcccatggaatcctcctgatgaacagcaatgcc
atggacgtgacattgcagcccatgcctgctctgacgtaccgcaccacagggggagttctg
gatttttttgtatttttggggccaactcctgagcttgtcactcagcaatacacagagttg
attggtcggcctgtgatggtaccatactggtccctgggattccagctgtgtcgctatgga
tatgagaatgatactgagatcgccaacctgtatgatgacatggtggctaagaagatcccc
tatgatgtgcagtactcagacattgactacatggagaggcagctggacttcaagctcaac
cctaagttctctgggtttccagacctgatcaatcgtatgaagcatgatgggatgcgggtc
atcctcattctggatccagctatttctggcaatgagacagagccctaccctgccttcacc
aagggagtggagaatgacgtcttcatcagatatcccaataatggagacattgtctgggga
aaggtctggcctgattaccctaatatcactgtggacccatctctagactgggacagtcaa
gtggagcaataccgagcttatgtggccttcccagactttttccggaattcaactgccctc
tggtggaaggatgagattaaagaactccacagcaacacacaggatcctgcaaagagcttg
aagtttgatggcctgtggattgacatgaatgaaccttccagctttgtgaatggggcagtt
ccctctggctgcagtgatgctactctgaaccgccctccctacatgccacatttggaagcc
agggacaggggcctgagcagcaagaccctgtgcatggagagcgagcacatccttccagat
ggctcccgggtgcggcactatgatgtacacagcctgtatgggtggtcccagaccagaccc
acctacgaagcagtgcaggaggtgacaggagagagagggatcgtcatcacccgctccaca
ttcccctcttctggacgctggggaggacactggttgggagacaacacagctgcctgggac
cagctggggaaatccatcattggcatgatggatttcagcctctttggcatatcctatact
gggtcagacatctgtgggttctttcaagatgccgaatatgagatgtgtgttcgctggatg
cagctgggcgccttttaccccttctccaggaaccacaacaccatcgggaccaggagacaa
gaccctgtatcctggaataaaacctttgaggatatttccagaagcgtgctggagaccaga
tacaccctgttgccatatctctacaccttgatgtacaaggcccacacagagggcagcaca
gtcgtgcggcctcttctccatgagtttgtgtcagaccgggagacctggaatatagacaaa
cagttcctgctgggtccagcctttctagtcagccctgtgctagaacctaatgccagaaca
gttgcagcatattttcccaaagcccgctggtatgactactacacgggcgtagatatcaat
gcaaggggagagtggaagaccttgcaagcccctcttgagtacattaatcttcatgttcgt
gggggctacattctgccatggcaggagcctgccatgaacacccagttaagccggaagaag
tcaatgggcctcaaggctgcgttgaatgatgagggacttgcagaaggctggctcttctgg
gatgatggaaaaagcatcaatatcaccaatcagtactacttggccaggttttctgtcagc
cagaatacattgcagacacatgaaatgtttaacaactacatcactggcacagtacccttg
tatctaggctacattgaaatctggggattatccagtccttccattaccagtgtgaggatc
tctgggaaaaatcttaatgaagaagtcttagctgactacaacaccacaacccagatatta
cgtgtcaatgtgacagacaaaaatatcagcctgcatgctttccagtcactgacgtggagc
tag

DBGET integrated database retrieval system