KEGG   Rattus norvegicus (rat): 113927
Entry
113927            CDS       T01003                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase 1, alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113927 (Csnk1a1)
   04340 Hedgehog signaling pathway
    113927 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113927 (Csnk1a1)
   05226 Gastric cancer
    113927 (Csnk1a1)
   05224 Breast cancer
    113927 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113927 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    113927 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113927 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    113927 (Csnk1a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113927 (Csnk1a1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   113927 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin APH Kdo ABC1
Other DBs
NCBI-GeneID: 113927
NCBI-ProteinID: NP_446067
RGD: 71098
Ensembl: ENSRNOG00000017106
UniProt: P97633
LinkDB
Position
18q12.1
AA seq 325 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQGKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGF
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtgggaaatacaaactggtg
cggaagatcggatctggttccttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caaggaaaagactataatgtgctagtcatggatcttctgggacccagcctcgaagacctc
ttcaatttctgttcaagaaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagggaagataaaaac
ctcactggcactgcccggtatgccagcatcaatgcacatcttggcattgagcagagtcgc
cgagatgacatggaatctttaggatatgttttgatgtattttaatagaaccagtctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccactcctgttgaagttttgtgtaaggggtttcctgcagaatttgccatgtactta
aattactgtcgtgggctgcgctttgaggaagctccggattacatgtatctgaggcagctg
ttccgcatcctcttcaggaccctgaaccaccagtatgactacacgtttgattggacgatg
ttaaagcagaaagcagcccagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggtttctaa

KEGG   Rattus norvegicus (rat): 58822
Entry
58822             CDS       T01003                                 

Gene name
Csnk1e
Definition
(RefSeq) casein kinase 1, epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
rno04710  Circadian rhythm
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    58822 (Csnk1e)
   04340 Hedgehog signaling pathway
    58822 (Csnk1e)
   04390 Hippo signaling pathway
    58822 (Csnk1e)
   04392 Hippo signaling pathway - multiple species
    58822 (Csnk1e)
   04068 FoxO signaling pathway
    58822 (Csnk1e)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    58822 (Csnk1e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    58822 (Csnk1e)
   05022 Pathways of neurodegeneration - multiple diseases
    58822 (Csnk1e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    58822 (Csnk1e)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    58822 (Csnk1e)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     58822 (Csnk1e)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   58822 (Csnk1e)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    58822 (Csnk1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 58822
NCBI-ProteinID: NP_113805
RGD: 62045
Ensembl: ENSRNOG00000013076
UniProt: Q9JJ76
LinkDB
Position
7q34
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQQAG
NTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQEVSRIAASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctgcgtgtgggaaacaagtatcgcttgggccggaagatcggcagtgggtccttt
ggcgacatctacctgggtgccaacattgcctctggtgaggaagtagccatcaagctcgaa
tgtgtgaagacgaagcacccacagctccacatcgagagcaagttctacaagatgatgcag
ggaggagtggggatcccatccatcaagtggtgcggggctgagggtgactataacgtgatg
gtcatggagttgctggggcccagcctggaagacctcttcaacttctgttcccgaaagttc
agcctcaagacggtgctgctgctggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtgaagcctgacaacttcctcatgggcctggggaag
aaaggcaatctggtatacatcattgacttcggcctggccaagaagtaccgggatgcccgt
acacaccagcatattccctaccgggaaaacaagaacctgaccggcactgcccgctatgcc
tctatcaacacccacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tatgtgctcatgtacttcaacctgggctccctgccctggcaaggcctcaaagcagccacc
aagcgtcagaagtacgagcggatcagcgagaagaagatgtcaacgccgatcgaggtcctc
tgcaaaggctacccctctgagttctcaacttacctcaacttctgccgctccctgcggttc
gatgacaaacctgactactcctacctgcgccagctcttccgcaatctctttcaccggcag
ggtttctcctatgactacgtcttcgactggaacatgctcaaattcggtgcagcccggaat
cccgaggacgtagaccgggagagacgagagcacgaacgggaagagaggatgggacagttg
cgagggtccgcgaccagagccctgccccctggcccaccaacaggggctaccgccaaccga
ctccgaagtgcagccgagcctgtggcttccaccccggcctcccgcatccagcaagctggc
aatacttctcccagagcgatctcacgggcagaccgagagaggaaggtgagcatgagactc
cacagaggtgcgcctgccaatgtctcatcctcagacctcactgggcgacaagaggtctcc
cgaattgcagcctcacagacaagcgtgccatttgaccatcttgggaaatga

KEGG   Rattus norvegicus (rat): 64086
Entry
64086             CDS       T01003                                 

Gene name
Csnk1g1
Definition
(RefSeq) casein kinase 1, gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64086 (Csnk1g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64086 (Csnk1g1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64086 (Csnk1g1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64086 (Csnk1g1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal CK1gamma_C PIP49_C
Other DBs
NCBI-GeneID: 64086
NCBI-ProteinID: NP_071624
RGD: 621404
Ensembl: ENSRNOG00000016620
UniProt: Q62761
LinkDB
Position
8q24
AA seq 390 aa
MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLRYVRRLDFFE
KPDYEYLRNLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQPRSLTAEWFVLAPLSHPPAPT
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaccattctaatagagaaaaggatgatagacaacggacaactaaaaccatggcacaa
aggaatacacactgttcccgaccatctggcacttcaacatcctctggggttctcatggtg
ggacccaacttcagggttggcaagaagatagggtgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagccattaaactggaaccaataaaatcacgt
gctccacaacttcatttagagtacaggttttataaacagctcggcagtgcaggtgaaggt
ctcccacaggtttattactttggaccatgtgggaagtacaatgccatggtgctggaactc
ctcggccctagcttggaagacttgtttgacctctgtgaccgaacgtttactttgaagacg
gtgttaatgatagccatccagttgctttctcgaatggagtatgtacactcaaagaatctc
atttaccgagatgtcaaaccagagaacttcttaattggccgacaaggcaataagaaagag
catgtaatacacattatagattttggactggccaaggaatacattgatcctgaaaccaaa
aaacacataccttacagagagcacaaaagcttaactggaactgcgcgatacatgtctatc
aacacacatctaggcaaagagcaaagccggcgggatgatttggaagccctgggccatatg
ttcatgtacttccttcgaggcagcctaccctggcaaggactcaaggctgatacattaaaa
gagagatatcagaaaattggtgataccaaaaggagtactcccatcgaagctctctgtgag
aactttccagaggagatgatgacctaccttcgatatgtcaggagattagacttctttgaa
aaacctgattatgagtatttacggaacctcttcacagatctgtttgaacggaaaggctat
acttttgactatgcctatgattgggttggaaggcctattcctactccagtaggatcagtt
catgtagattctggtgcatctgcaataactcgagaaagccacacacacagggatcgacca
tcacaacaacagcctcttagaaatcagccaagatctttaacagcagagtggtttgtgctg
gctcccctttcccaccctccagcacccacataa

KEGG   Rattus norvegicus (rat): 64462
Entry
64462             CDS       T01003                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase 1, delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04540  Gap junction
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64462 (Csnk1d)
   04390 Hippo signaling pathway
    64462 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    64462 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    64462 (Csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64462 (Csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64462 (Csnk1d)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64462 (Csnk1d)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64462 (Csnk1d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    64462 (Csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 64462
NCBI-ProteinID: NP_620691
RGD: 71031
Ensembl: ENSRNOG00000036676
UniProt: Q06486
LinkDB
Structure
PDB: 
1CKI 1CKJ

Position
10q32.3
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctattcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagacgtgaaaccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcccgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacacaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactccaattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccag
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggaccgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacatacggccaacacctctcctagacccgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

KEGG   Rattus norvegicus (rat): 64823
Entry
64823             CDS       T01003                                 

Gene name
Csnk1g3
Definition
(RefSeq) casein kinase 1, gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64823 (Csnk1g3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64823 (Csnk1g3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64823 (Csnk1g3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64823 (Csnk1g3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 64823
NCBI-ProteinID: NP_074046
RGD: 621408
Ensembl: ENSRNOG00000016677
UniProt: Q62763
LinkDB
Position
18q11
AA seq 448 aa
MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKAQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKIQQS
KNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITA
PTEVEVMDETKCCCFFKRRKRKTIQRHK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggataataaaaagaaagacaaggacaaatcagatgacagaatggcacggcccagtggt
cggtcagggcacagcactcgaggaactgggtcttcttcatctggagttttaatggttgga
cctaactttagagttgggaaaaaaattggatgtggcaattttggagaattacgattaggg
aaaaatttatatacaaatgaatatgtggcgattaaactggagcccatgaaatccagagca
ccacagctgcatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactattttggcccttgtggtaaatacaacgctatggtgctggaactgctggga
cctagtttggaagatttgtttgacctctgtgatagaacattttctcttaaaaccgttctc
atgatagctatacagctgatttctcgcatggagtatgtccactcaaagaacttgatatac
agagatgtgaagcccgagaatttcttaataggacggccaggaaacaaagcccagcaagtc
attcacatcatagattttggtttggcaaaggaatatattgatccagagacaaagaaacat
ataccatacagagaacacaaaagccttactggaacagccagatacatgagcataaacaca
catctaggaaaagaacagagcagaagagacgatttagaagctttaggacatatgttcatg
tatttcctgagaggcagtcttccttggcaaggcctaaaggcagatacattaaaagagaga
tatcagaaaattggagacacaaaacgagccacaccgatagaagtgctgtgtgaaaacttc
ccagaagaaatggcaacatatcttcgttacgtacgaaggctagatttttttgaaaagcca
gactatgattacttaagaaagctttttactgacttgtttgatcgcaaagggtatatgttt
gattatgaatatgactggattggtaaacagttgcctactcctgtaggtgcagttcagcaa
gacccggctctgtcatcgaacagagaagcacaccaacacagagacaagatacagcagtct
aaaaaccagtcggcagaccacagggcagcttgggactcccagcaggcaaatccccaccat
ttgagagctcaccttgcagcagacagacatggtggctcggtacaggttgtaagttctaca
aatggagagctaaacacggatgaccccacggcgggacggtcaaatgcacccattacagcc
cctacggaagtagaagtgatggatgaaaccaagtgctgctgctttttcaaacgaaggaaa
aggaaaaccatacaacgtcacaagtga

KEGG   Rattus norvegicus (rat): 65278
Entry
65278             CDS       T01003                                 

Gene name
Csnk1g2
Definition
(RefSeq) casein kinase 1, gamma 2
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    65278 (Csnk1g2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    65278 (Csnk1g2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65278 (Csnk1g2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   65278 (Csnk1g2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 65278
NCBI-ProteinID: NP_001029042
RGD: 621407
Ensembl: ENSRNOG00000018529
UniProt: Q62762
LinkDB
Position
7q11
AA seq 415 aa
MDFDKKGGKGELEEGRRMSKTGTNRSNHGVRNSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSTTEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGYVFDYEYDWAGKPLPTPIGTVHPDVPSQPPHRDKAQLHTK
NQALNSTNGELNTDDPTAGHSNAPIAAPAEVEVADETKCCCFFKRRKRKSLQRHK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaaggagggaagggggagttggaggagggcaggagaatgtccaaa
accggcacgaatcggagcaaccacggcgtccgcaattcggggaccagctcaggggtcctg
atggtgggccccaacttccgagtcggcaagaagataggctgtgggaatttcggggagctt
cgcctaggaaagaacctgtatacaaatgagtacgtggctatcaaactggagcccatcaag
tcccgggccccgcagctgcatctggagtaccgcttctacaagcagctcagcaccacagaa
ggtgtccctcaggtctactacttcggcccttgcgggaagtacaacgccatggtgctggag
ctgctggggcccagcctggaggacctgttcgacctgtgcgaccgcaccttcacgctaaag
acggtgctgatgatcgccatccagctgatcacgcgcatggagtatgtgcataccaagagc
ctcatctaccgcgacgtgaagcctgagaacttcctggttgggcggccgggcagcaagcgg
cagcactccatccacatcatcgactttggcctggccaaggagtacatcgaccctgagacc
aagaagcacatcccgtaccgcgagcacaagagcctgacgggcacggcgcgctacatgagc
atcaacacgcacctgggcaaggagcagagccgccgggacgacctggaagcgctagggcac
atgttcatgtacttcctacgcggcagtctgccctggcaggggctcaaggcggacacgctg
aaggaacgctaccagaagattggtgataccaagcgtgccacgccaatcgaggtgctgtgt
gagagcttcccggaggagatggccacctacttgcgctatgtgcggcgcctagacttcttt
gagaagccagactacgactacctgaggaagctcttcaccgacctcttcgaccgcagcggc
tacgtgtttgactacgagtatgactgggccggcaagcccctgccgacacctatcggcacc
gtccatcctgatgtgccctcccagccgccacatcgtgacaaagctcagctccacaccaag
aaccaggcgctgaactccaccaatggagagctgaacacagacgaccccaccgcgggccac
tccaacgcccccatcgcggcccctgcagaagtagaggtggcggatgaaaccaagtgctgc
tgcttcttcaagaggaggaagagaaaatcgctgcagcgacataagtga

DBGET integrated database retrieval system