KEGG   Rattus norvegicus (rat): 114029
Entry
114029            CDS       T01003                                 

Gene name
Megf8, Egfl4
Definition
(RefSeq) multiple EGF-like-domains 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114029 (Megf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    114029 (Megf8)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   114029 (Megf8)
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_6 Kelch_1 CUB Laminin_EGF EGF_CA EGF_3 PSI PSI_integrin EGF_2 EGF
Other DBs
NCBI-GeneID: 114029
NCBI-ProteinID: NP_446080
RGD: 621190
Ensembl: ENSRNOG00000052687
UniProt: R9PXW3
LinkDB
Position
1q21
AA seq 2789 aa
MALGGALAAALALAFAVLGPLSHKVLAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPQGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCQNHGQCKSPGVCVCEPGWGGPDCGLQECSAYCGS
HGTCASTLGPCRCEPGFLGRACDLHLWENQGAGWWHSVSAGDPAFSARVGAAGAFLSPPG
LLAVFGGQDLNKALGDLVLYNFSTNTWESWDLTPAPAARHSHVAVAWAGFLVLMGGELAN
GLLTNDVWAFSPLGGGHWELLAPPASSSSGPPGLAGHAAALVDDIWLYVSGGRTQHDLFS
SGLFRFRLDHTSRGYWEQVIPAGGRPPAATGHSMVFHAPSRTLLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPALDYHLDYCSMYTDHSVCSRDPECSWCQGACQSAPPPGTPSGACPAA
SCLGLGRLLSDCQACLAFSSPTAPPRGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKVSIVRSTTITLTPSAETDVSL
VYRGFIYPMLPGGPGGPGAEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKET
RRLQRPGSSRLFPLPGRGNKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSLACSSYSSCLGCLADQGCGWCLNSATCHLRQGRAHCEDDGNGESLLVLVPALCPL
CEEHRDCHACTQDPFCEWHQSTNRKGDAACSRRGRGRGALKNPEECPPLCSQRLTCEDCL
ANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCHGFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRL
GLARCHPRATCLNTPLSYECHCQRGYQGDGITHCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPPPTPAPGPPAPRCSRDCGCNFHSHCRRRGPGYCDECQDWTWGEHCERCRPGSFG
NATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQICSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRFGGLLPPGGGTARAGPGLSYCVWVVSATEALQPCAPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWA
GPHCRMALCPENCNAHTGAGICNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGITCDFWVLNLTTLQWRQEKAPQSIELPAV
AGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDT
MVVLGGRSDPDEFSSDVLLYQVNCNTWLLPDLTRPAFVGSPMEESVAHAVAAVGSRLYIS
GGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHGACLSGDQAHRLGCGVPPCS
PMPRSPEECRRLRTCSECLARHPRTLQPGDGEASVPRCKWCTNCPEGACIGRNGSCTSEN
DCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLASKGADGGWQHCVWSSSLQQCLSPS
YLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGHCMEGGLS
GPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNVT
GVCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNH
TKGSHCEQCLPLFVGSALGGGTCRPCHAFCRGNSHVCVSRKELEMARREPEKYSLDPEEI
EAWVAEGPSEDEAVCVNCQNNSYGDRCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTG
CPCQNNTETGVCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPT
SQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVA
PDTGVHTVHIQPPPPPPPPPPPADGVPRVASDLGGLGTGSGSGSPVEPRVREVWPRGLIT
YVTVTEPSAVLVVRSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPNGPGANGSADSQGL
LFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRP
FAKVTVCFPPDPAGPAPAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAL
PATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGG
SGGAGGSGHGGGGGRKGLLSQDNLTSMSL
NT seq 8370 nt   +upstreamnt  +downstreamnt
atggccttgggcggagctctggccgcggcccttgcactggccttcgctgtgctggggccg
ctgtcccacaaggtcctggccggtgactgcaaggggcagcggcaggtgctacgggaggca
ccaggcttcgtgacggatggtgcgggcaactacagcgtcaatggcaactgcgagtggctt
atcgaggcaccgagccctcagcaccggatcctgctggacttccttttcctggacacagag
tgcacttatgactacctctttgtgtatgatggtgactcaccccaaggcccgctgcttgct
agtctgagtgggagcacccggcccccacccatcgaggcatcctcaggcaagatgctgctc
catctcttcagtgatgccaactacaacctgctgggctttaacgcctccttccgcttctcc
ctgtgtcctggaggttgccagaaccacgggcagtgcaagtctccaggagtgtgtgtctgc
gagccaggctgggggggtccagactgtggcctgcaggagtgctcagcctactgtggtagc
cacggtacctgtgcctcgaccctgggaccatgccgctgtgagcctggattcctgggacgg
gcctgtgacctgcacttgtgggagaaccagggggctggctggtggcacagtgtgagtgcc
ggggaccccgccttctctgcccgagttggggcagctggtgccttcctgtctccaccaggg
ctgctggctgtctttggaggtcaggaccttaacaaggccctgggggatcttgtcctgtac
aacttctccaccaacacctgggaatcctgggatctgacgcctgctccggccgcccgtcac
tcccacgtggccgtggcctgggccggcttcctggtgctgatgggtggtgagctggccaat
ggcttgctaaccaacgatgtgtgggcctttagccccctgggtggaggccactgggagctc
ctggcaccacctgcttccagttcctctgggcccccagggctggcaggccatgcagcagct
ctggtagatgacatctggctgtatgtgtccggtggccgcactcagcatgacctcttttct
tctggcctcttccgcttccgcctggaccacaccagcaggggctactgggagcaggtgatc
cctgcaggtgggcggccccctgctgccactggccactctatggtgttccacgccccgtcc
cgtaccctgctggtccatggtggacaccggccttccactgcccggttttccgtgcgggtg
aattccaccgagctcttccacgtggaccgccgtgtgtggaccacgctgaagggccgggat
gggctccagggtccacgggagagagccttccacacagccagtgttctaggaaactacatg
gtggtctatgggggcaatgtgcacacccattaccaggaggaaaagtgttacgaagatggc
atcttcttctaccaccttggttgccaccaatgggtgtcgggggccgaacttgccccacca
gggacccctgaaggtcgagcagcgccccctagtggtcgttactcacatgtggcagctgtt
ctcggtggcagtgtcctgctggtggctgggggatacagtggccggcctcgtggggacttg
atggcctacaaggtgccccccttcgtgtttcaggcacccgccctggattaccacttggac
tactgttccatgtacacagaccacagtgtgtgctcccgggaccccgaatgtagctggtgt
cagggtgcttgccaatccgcaccccctcccgggactccctcaggagcttgtcccgcagcc
agctgcctgggcctaggccgcctactgagtgactgccaggcatgcctggccttcagcagc
cccacggctcctccccgaggacctggcaccctaggttggtgtgtgcacaacgagagctgc
cttccccggccagagcaggcacgctgccgaggggagcagatctcaggcactgtgggctgg
tgggggccagcacccgtctttgtcacttccctggaggcttgtgtcacccagagcttcctc
cctggcctgcacctgctcaccttccagcagccacccaacgcctctcagcctgacaaggtc
tccattgtccgaagtacaactatcaccttgacccccagcgcggagacagatgtgtccctg
gtctaccgaggcttcatctacccgatgctgccaggaggaccaggtggccctggggccgaa
gatgtggctgtgtgggctcgggcccagcgcctccatgtcctggcccggatggccagaggc
cctgacactgagaacatggaagaggtgggacgctgggtggctcagcaggagaaggagaca
cggcgtctgcagcgccccggctctagtcgcctcttcccactgcccggtcgaggcaacaag
tatgctgtggagatccgaggccagctcaatggctccgcaggccctgggcacagtgagctc
actctcctgtgggatcggactggagtgccgggtggcagtgagatctccttcttcttcctg
gagccctaccgctctttggcctgctcctcctactcctcctgtctgggctgcctggccgat
cagggctgtggctggtgcctcaacagtgccacctgtcacctgcgtcagggcagggcccac
tgtgaggatgacgggaacggcgagtccttgctggtgctggtgcctgccctctgtccactc
tgtgaggagcatcgtgactgccatgcctgcacccaggaccccttttgtgagtggcatcag
agcaccaaccgcaaaggtgacgcagcctgcagccggcgaggccggggccgaggcgctctg
aagaatcccgaggaatgccccccactctgcagccaacgcctgacctgtgaggactgcctg
gccaactctagccagtgcgcctggtgccagtcaactcacacctgcttcctgtttgctgcc
tacctggcccggtacccacacgggggctgccgtggctgggacgacagtgtgcattcagag
ccacgctgcaggagctgccacggatttttgacttgtcacgagtgtctacagagccacgag
tgtggttggtgtggcaatgaagacaaccccactctgggacggtgcctacagggggacttc
tccggacccctgggtggggggaactgctccctgtgggtgggagagggcctggggctgcct
gtggctcttcctgctcgctgggcttatgcccgctgtccagatgtggatgaatgtcgcctg
ggtctggcgaggtgtcacccacgggcaacgtgcctcaacacgcctctcagctatgagtgt
cattgccagcgcggctaccagggtgatggcatcacacactgtaaccgcacgtgcctggaa
gactgtggccacggtgtgtgtagcggtcccccggacttcacttgcgtgtgtgacctgggt
tggacctcagatttgccaccacccacacctgccccaggaccccctgccccacgctgctct
cgagactgtggctgcaactttcacagtcattgccgccggcggggacctggctactgtgat
gagtgccaggactggacatggggggaacactgtgaacggtgccggcctggcagctttggc
aatgcaacgggctctggtggctgccgaccctgccagtgtaacgggcatggagacccacgt
cgtggccactgtgacaacctcagtgggctctgcttctgccaggaccatactgaaggtgcc
cactgtcagatttgctctccaggatactatggggacccccgagctggtggctcctgcttc
cgggagtgtgggggtcgtgccctcctcaccaatgtgtcctcagtggctctgggctctcgc
cgctttgggggacttctgcctccaggtggtgggacagcaagagctggacccggcctgtcc
tactgtgtgtgggttgtctcagccacagaagcgctgcagccctgtgcccctgggaccctc
tgtcccccactcaccctcaccttctctccagacagcagcaccccttgcacactgagctat
gtcctggcctttgatggattcccacgctttctggacactggggtcgtccagtcagaccgg
agcctcatagctgccttctgtggtcagcggcgggacagacctctcaccgtgcaggcttta
tctgggttacttgtgttgcactgggaggccaatggctcctcctcctggggattcaatgct
tccgtgggctctgcccgatgtggatcaggaggccctggcagttgccctgtccctcaggag
tgtgtgccccaggatggggctgcaggtgctgggctctgccgatgtcctcagggctgggct
gggcctcactgccgcatggctctgtgtcctgagaactgcaacgcccacacgggggcaggg
atttgtaaccagagcctaggtgtgtgcatctgtgctgagggctttggtggcccagactgt
gccacgaagctggatggtgggcagttggtctgggaaacactcatggacagccgcctctca
gctgacactgctagtcgcttccttcaccgcctggggcatactatggtagagggacctgat
gctactttgtggatgtttgggggactgggtctgccgcagggcctgctgggaaacttgtat
aggtattcagtcagtgagcgcaggtggacacagatgctggcaggagctgaggatgggggc
ccaggcccatcaccccgctcctttcacgcagctgcctatgtacctgctggccgtggtgcc
atgtacctgctggggggcctcacagctgggggcatcacctgtgacttctgggtccttaac
ctcactaccctacagtggagacaggagaaggcccctcagagcatagagctgccagcagtc
gctggtcacacccttactgcccgtcgaggcctgtctctgctcttggtgggtggctactcc
cctgaaaatggcttcaaccagcagttgttggagtaccagctggcaaccggcacgtgggtg
tctggagcccagagtgggacgcccccaacaggtctctatggccattctgcggtctaccat
gaggccaccgactccctctatgtgtttgggggtttccgcttccatgtggaattggcggcg
ccttctccggagctctactccctgcactgtcctgaccgcacctggagcttgctggcacct
tctcagggggccaagccccggccccggctcttccatgcctcagccctgctgggggacacc
atggtggtcctcggggggcgctcggaccccgatgaattcagcagtgatgtcctgctctac
caggtcaactgcaacacctggctcctgcctgacctcacccgtccagcctttgtggggtcc
ccgatggaggagtccgtggctcacgcagtggcagcagtgggtagccgcctgtacatctct
ggaggatttgggggagtagccttgggccgcctgctggcattaaccctgccccctgacccc
tgtcgtctgctgccttcacctgaagcttgcaaccagtctggggcctgcacctggtgccat
ggtgcttgcctgtctggggaccaggcccacagactgggttgtggggtgcccccttgctcc
ccaatgcctcgctcgcctgaggaatgtcggagactgcggacctgcagtgagtgcctggcc
cgccatcctcggaccctgcagcctggagatggagaggcatccgttccccgctgtaagtgg
tgcactaactgcccagagggcgcctgcatcgggcgcaatgggtcctgcacctccgagaat
gactgtcgaatcaaccaacgagaggtcttctgggctggtaactgctcagaggccgcatgc
ggggctgccgactgtgagcagtgcacacgggagggaaagtgcatgtggactcggcaattc
aagaggactggggagactcggcgtatcctgtcagtgcagcccacctacgactggacttgc
ttcagccattctctgctgaatgtgtctcctatgccggtggagtcctcacccccactgccc
tgtcccaccccctgtcacctcctccccaattgcacatcctgcctggcctccaagggtgca
gatggaggctggcagcactgtgtgtggagcagcagcctccagcagtgtctgagcccctcc
tacctgcccttacgctgtatggctggaggctgtgggcggctgcttcgggggccagagagc
tgctccctgggctgtgctcaggctacgcagtgcgccctgtgtctgcgaagaccccactgt
ggctggtgtgcctgggggggacaggatggaggtggccactgcatggaaggtggtctcagt
ggcccccgagatgggctcacgtgtggacgtcctggggcatcctgggccttcctgtcctgc
ccccctgaggacgagtgtgcaaacgggcaccatgactgcaatgagactcagaactgccac
gaccagccccacggctacgagtgcagctgcaagacaggctacaccatggacaatgtgact
ggcgtctgccgccctgtgtgtgcccagggctgtgtgaacggctcctgtgtggagcctgat
cactgccggtgtcactttggctttgttggccgcaattgctccacagagtgtcgttgcaat
cgccacagtgagtgtgctggcgttggagcacgggatcactgcctgctgtgccggaaccac
accaagggtagccactgtgagcagtgtctcccactgtttgtgggttcggctttgggtggc
gggacctgccggccatgccatgccttctgtcgagggaacagccatgtgtgtgtctccagg
aaagagctagaaatggccagaagggagccagagaagtactcactggatccagaggagatt
gaagcctgggtggcagaagggcctagtgaagatgaagctgtgtgtgtgaactgccagaac
aacagctacggagacagatgtgagagctgcctgcacggctacttcctcctggacgggaaa
tgcaccaagtgccagtgcaatggccacgctgacacctgtaacgagcaggacggaacagga
tgcccatgtcagaacaacacagagacaggcgtctgccagggcagctctcctagtgaccgc
cgagactgctacaagtaccagtgtgctaagtgccgggagtcattccacgggagcccactg
ggtggccagcagtgttaccgactcatctcggtggagcaggagtgctgcctggaccccact
tcccagaccaactgcttccatgagccgaagcgccgggccttgggtcctggccgaactgtg
ctgtttggcgtccaacccaagttcaccaatgtggacatccgcctgacactagacgtgacc
ttcggtgctgtggacctctatgtctccacttcctatgacacttttgtggtccgagtggcc
cctgacacaggtgtccacactgtgcacatccagccacccccacctcccccacctcctccg
cctcctgccgatggtgtacctcgtgtggcttcggacctaggaggactggggaccggaagt
ggatcaggttctccagtggagccacgagtccgcgaggtgtggccacggggcctgattacc
tatgtgacagtgacggaaccctcggcagtgctggtggtccgcagtgtgcgggacaggctg
gtgatcacctatccccatgagcaccacgccctcaagtccagccgcttctacctgctgctg
ctgggggtaggggatcccaacgggcctggggccaacggctcggcggactcacagggcctg
ctcttcttccggcaagaccaggcccacattgacctgttcgtcttcttctctgtcttcttt
tcctgcttcttcctcttcctctcactctgtgtgctcctctggaaggccaagcaggctctg
gaccagcggcaagagcagcgccggcacctgcaggagatgaccaagatggctagccgcccc
tttgccaaggtcacagtctgcttccctccagaccctgcgggcccagcacctgcctggaag
ccagctggcctcccgcctcctgccttccgccgctccgagccatttcttgcacctctactg
ctgacaggagctggggggccctggggacccatgggaggagggtgctgcccaccagctctc
cctgccaccacagctggcctacgagctgggcccattacccttgaacccacagaagatggc
atggctggtgtggccactctgctgctccagctacctggggggcctcatgctcccaatggg
gcctgccttgggtcagcccttgtcactctgcgtcataggctgcatgagtactgtggggga
agcgggggtgctgggggcagtggacatgggggtggtggaggccggaagggactgttaagt
caggacaatctcactagcatgtccctttga

DBGET integrated database retrieval system