KEGG   Rattus norvegicus (rat): 114851
Entry
114851            CDS       T01003                                 

Gene name
Cdkn1a, Cip1, UV96, Waf1
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04630  JAK-STAT signaling pathway
rno04921  Oxytocin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114851 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    114851 (Cdkn1a)
   04066 HIF-1 signaling pathway
    114851 (Cdkn1a)
   04068 FoxO signaling pathway
    114851 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    114851 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114851 (Cdkn1a)
   04115 p53 signaling pathway
    114851 (Cdkn1a)
   04218 Cellular senescence
    114851 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    114851 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    114851 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114851 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    114851 (Cdkn1a)
   05206 MicroRNAs in cancer
    114851 (Cdkn1a)
   05205 Proteoglycans in cancer
    114851 (Cdkn1a)
   05203 Viral carcinogenesis
    114851 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114851 (Cdkn1a)
   05212 Pancreatic cancer
    114851 (Cdkn1a)
   05225 Hepatocellular carcinoma
    114851 (Cdkn1a)
   05226 Gastric cancer
    114851 (Cdkn1a)
   05214 Glioma
    114851 (Cdkn1a)
   05216 Thyroid cancer
    114851 (Cdkn1a)
   05220 Chronic myeloid leukemia
    114851 (Cdkn1a)
   05217 Basal cell carcinoma
    114851 (Cdkn1a)
   05218 Melanoma
    114851 (Cdkn1a)
   05211 Renal cell carcinoma
    114851 (Cdkn1a)
   05219 Bladder cancer
    114851 (Cdkn1a)
   05215 Prostate cancer
    114851 (Cdkn1a)
   05213 Endometrial cancer
    114851 (Cdkn1a)
   05224 Breast cancer
    114851 (Cdkn1a)
   05222 Small cell lung cancer
    114851 (Cdkn1a)
   05223 Non-small cell lung cancer
    114851 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114851 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114851 (Cdkn1a)
   05161 Hepatitis B
    114851 (Cdkn1a)
   05160 Hepatitis C
    114851 (Cdkn1a)
   05163 Human cytomegalovirus infection
    114851 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114851 (Cdkn1a)
   05169 Epstein-Barr virus infection
    114851 (Cdkn1a)
   05165 Human papillomavirus infection
    114851 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114851 (Cdkn1a)
   01522 Endocrine resistance
    114851 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114851
NCBI-ProteinID: NP_542960
RGD: 69328
Ensembl: ENSRNOG00000000521
UniProt: Q64315
LinkDB
Position
20p12
AA seq 164 aa
MSDPGDVRPVPHRSKVCRRLFGPVDSEQLSRDCDALMASCLQEARERWNFDFATETPLEG
NYVWERVRSPGLPKIYLSPGSRRRDDLGGDKRPSTSSALLQGPGPAPEDHVALSLSCTLV
SHAPERPEDSPGGTGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgatcctggtgatgtccgacctgttccacacaggagcaaagtatgccgtcgtctg
ttcggtcccgtggacagtgagcagttgagccgcgattgcgatgcgctcatggcgagctgt
ctccaggaggcccgagaacggtggaactttgacttcgccactgagacgccactggagggc
aactacgtctgggagcgtgttcggagcccagggctgcccaagatctacctgagccctggg
tcccgccgccgtgatgacctgggaggggacaagaggcccagtacctcctcggccctgctg
caggggccagggccagctccggaggaccacgtggccttgtcgctgtcttgcactctggtg
tctcacgcccctgagaggcctgaagactccccgggcgggaccgggacatctcagggccga
aaacggaggcagaccagcctaacagatttctatcactccaagcgccgattggtcttctgc
aagagaaagccctga

DBGET integrated database retrieval system