KEGG   Rattus norvegicus (rat): 157074Help
Entry
157074            CDS       T01003                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    157074 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    157074 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    157074 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    157074 (Sdha)
   05012 Parkinson disease
    157074 (Sdha)
   05016 Huntington disease
    157074 (Sdha)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    157074 (Sdha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     157074 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 157074
NCBI-ProteinID: NP_569112
RGD: 621557
Ensembl: ENSRNOG00000013331
UniProt: Q920L2
LinkDB All DBs
Position
1p11
AA seq 656 aa AA seqDB search
MAGVGAVSRLLRGRRLALAGATRGFHFSVGESKKASAKVSDAISTQYPVVDHEFDAVVVG
AGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVK
GSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHR
CCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIR
AKNTIIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLIT
EGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQL
HHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVNGQ
DQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPPIKANA
GEESVMNLDKLRFADGSVRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKVSQLYGDLQH
LKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSK
PIEGQQKKPFAEHWRKHTLSYVDTKTGKVTLDYRPVIDKTLNEADCATVPPAIRSY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggccggggttggcgcagtttcgagacttcttcgcgggcggcgcttggctctagctggg
gcgactcgtggctttcacttctctgttggtgagagcaagaaggcatccgctaaagtttca
gacgcgatttctacccagtaccccgtggtggaccatgagtttgatgctgtggttgtaggt
gcaggcggggcaggcttgcgagctgcattcggcctttctgaggcaggctttaacacggca
tgccttacaaagctctttcctacccgctcacatactgttgcagcacagggaggtatcaat
gctgccctggggaacatggaagaggacaactggagatggcatttctatgacaccgtgaaa
ggctctgactggctgggggatcaggatgccatccattacatgacagagcaagctcctgcc
tccgtggttgagctagaaaattacggtatgccgtttagcaggactgaagatgggaggatt
tatcagcgtgcatttggtggacagagcctcaagttcgggaaaggcgggcaggcccatcgg
tgttgctgtgtcgctgatcggacgggccactcactcttacacaccttgtatggacgatct
ctgcggtatgacaccagttattttgtggagtatttcgcactggatcttctgatggaaaat
ggggagtgccgtggtgtcattgcactgtgcatagaagatgggtccatacaccgaataaga
gcaaagaacactattattgctactgggggctatgggcgaacctacttcagctgtacttct
gcccacaccagcacaggggacggcacagccatggtcactcgggctggtttaccttgccag
gacttagaatttgttcagttccaccccacaggtatctatggtgctggctgcctcatcaca
gaagggtgccgtggagagggaggcattctcatcaacagccaaggcgaaaggttcatggag
agatatgcccctgttgccaaggacctagcatcaagagatgttgtgtctcgatccatgact
ctcgagatccgtgaaggaagaggctgtggccctgagaaggatcacgtctacctgcagttg
caccatctgccccctgagcagctggccacgcgtctgcctgggatctcagagacggccatg
atcttcgccggcgtggatgtcaccaaggagcccattccagtccttcccactgtgcattac
aacatgggcgggattcccactaactacaagggacaggtgctgaagcacgtgaacggccag
gatcagattgtgcctggtctgtacgcctgtggggaggctgcctgcgcctcagtgcatggt
gccaaccggcttggagcaaactctcttttggaccttgtcgtctttggccgagcctgtgcc
ctgagcattgcagaatcttgcaggcctggagataaagttcctccgattaaggcaaatgct
ggagaagagtcggttatgaatcttgacaagttgagatttgctgatggaagtgtaagaaca
tcagagctgcgcctcagcatgcagaagtcgatgcagagccatgccgccgtgttccgtgtg
ggaagtgtgctgcaagaaggctgtgaaaaagtcagccagctctatggagacctacagcat
ctgaagacgtttgacaggggaatggtctggaacacagacctggtggagacgctggagctg
cagaatctgatgctgtgcgcactgcagaccatatatggtgcggaagcacggaaggagtca
cggggagctcatgccagggaagattacaaggtgcggattgatgagtatgattactccaag
cccatcgagggccagcagaagaagccatttgcggaacactggaggaagcacaccctctca
tatgtggacaccaagactgggaaggttactttggattacagacctgttattgacaagacc
ttgaatgaggctgactgtgctactgtacctcctgctatccgttcctactga

DBGET integrated database retrieval system