KEGG   Rattus norvegicus (rat): 171566
Entry
171566            CDS       T01003                                 

Gene name
Nme7
Definition
(RefSeq) nucleoside diphosphate kinase 7
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    171566 (Nme7)
   00240 Pyrimidine metabolism
    171566 (Nme7)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    171566 (Nme7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171566 (Nme7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     171566 (Nme7)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    171566 (Nme7)
SSDB
Motif
Pfam: NDK DUF1126 Arg_repressor
Other DBs
NCBI-GeneID: 171566
NCBI-ProteinID: NP_612541
RGD: 619880
Ensembl: ENSRNOG00000002898
UniProt: Q9QXL7
LinkDB
Position
13
AA seq 395 aa
MKAGQQGRSCGLISPYLAPKNQSERFAFIAEWYDPNASLLRRYELLYYPVDGSVEMHDVK
NRRTFLKRTKYEDLRVEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPD
AVSKAGEIIEMINKSGFTITKLRMMTLSRKEAADFHVDHHSRPFYNELIQFITSGPVIAM
EILRDDAICEWKRLLGPANSGIARSEAPGSVRALFGTDGIRNAAHGSDTFESAAREMELF
FPSSGGCGPTNTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFEISAIQMFNMDRANV
EEFYEVYKGVLSDYNDMVTELYSGPCVAIEIQQSNPTKTFREFCGPSDPEIARHLRPETL
RANFGKTKVQNAVHCTDLPEDGLLEVQYFFKILDN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaagctggtcagcagggaagaagttgcggtttgatttctccgtatcttgcacccaag
aatcagagtgagaggtttgctttcattgcagagtggtatgacccaaatgcttcactgctc
cgacgctatgagcttctgtactacccggtagatggatctgttgaaatgcatgatgtcaag
aatcgtcgcaccttcttaaagcggaccaagtatgaggacctgcgcgtggaagatttattt
ataggcaacaaagtcaatgtgttttctcgacagctggtgctgattgactatggggaccag
tacacagcccgccagctgggcagcaggaaagagaaaactttagccctcatcaaaccggat
gcagtatcgaaggctggagaaatcattgagatgataaacaaaagtgggttcactataacc
aaactccgaatgatgacgctgtcaaggaaagaagcagcagactttcatgtagaccaccac
tcaaggcctttttataacgaactgatccagtttatcacaagtgggcctgttattgccatg
gagatcttgagagatgatgccatatgtgagtggaaaaggttgcttggacccgcaaactct
gggatagcgcgttcagaagcccccggaagcgtccgagccctctttgggacagatggcata
agaaatgcggctcacggctctgatacttttgagtccgctgccagagaaatggaattattt
ttcccctccagtggaggctgtggcccaacaaacactgctaaatttaccaattgtacctgc
tgcattatcaagccccatgctatcagtgaaggaatgttgggaaagattttaatagctatt
cgagatgcatgctttgagatctcagcaatacagatgttcaatatggatcgagctaatgtt
gaagaattctatgaagtctataaaggtgtactgtccgattataatgacatggtgacagag
ctgtactccggcccttgcgtagcaatagagatccagcagagcaatcctacgaagacgttc
cgagaattctgtggaccttccgatcctgaaatcgccaggcatttacgacctgagaccctc
agggcaaattttggtaaaaccaaggttcaaaatgctgttcattgtacagatctgccagag
gatgggctcctggaggtccagtatttcttcaagatcttggataattag

KEGG   Rattus norvegicus (rat): 191575
Entry
191575            CDS       T01003                                 

Gene name
Nme1
Definition
(RefSeq) nucleoside diphosphate kinase A
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    191575 (Nme1)
   00240 Pyrimidine metabolism
    191575 (Nme1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    191575 (Nme1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    191575 (Nme1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     191575 (Nme1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    191575 (Nme1)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 191575
NCBI-ProteinID: NP_612557
RGD: 70497
Ensembl: ENSRNOG00000002693
UniProt: Q05982
LinkDB
Position
10
AA seq 152 aa
MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFIQASEDLLKEHYIDLKDRPF
FSGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEISLWFQPEELVDYKSCAQNWIYE
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccaacagcgagcgtaccttcatcgccatcaagcctgatggggtccagcgggggctt
gtgggagagatcatcaagcgattcgagcagaagggattccgcctggttggtttgaaattt
atacaggcttcagaggatcttctcaaggagcactacattgacctgaaggaccgccccttc
ttttctggcctggtgaagtacatgcactcaggaccggtggttgctatggtctgggaggga
ctgaatgttgtgaagacaggccgggtgatgcttggagagaccaaccccgcagactctaag
cctgggaccatacgaggagacttttgcattcaagttggcaggaacatcattcatggcagc
gattctgtggagagtgcggagaaggagatcagtttgtggtttcagcctgaggagctggtg
gactacaagagctgtgcgcagaactggatctatgagtga

KEGG   Rattus norvegicus (rat): 58964
Entry
58964             CDS       T01003                                 

Gene name
Nme6
Definition
(RefSeq) nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    58964 (Nme6)
   00240 Pyrimidine metabolism
    58964 (Nme6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    58964 (Nme6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    58964 (Nme6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     58964 (Nme6)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    58964 (Nme6)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 58964
NCBI-ProteinID: NP_001178813
RGD: 61896
Ensembl: ENSRNOG00000020721
UniProt: R9PXW5
LinkDB
Position
8
AA seq 186 aa
MTSILRSPQTLQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWKPEDCRRFY
REHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARHIAPDSIRGSLG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAET
GGPKPA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctccatcctgcgaagtcctcagactctccaactcacgcttgccctgatcaaacct
gatgcagttgcccacccactgattctggaggctgttcatcaacagattctcagcaacaag
ttcctcattgtacgaatgagagaattgctgtggaagccggaggactgccggaggttttac
cgagagcatgaaggtcgttttttctatcagaggctggtggagttcatgacaagtgggcca
atccgagcctacatccttgcccacaaagatgccatccaactttggaggacactgatggga
cccaccagagtgtttcgagcacgccatatagccccagattcaattcgtgggagtttgggc
ctcactgacacccgaaataccacccatggctcagactctgtggtttccgccagcagagag
atcgcagccttcttcccggacttcagtgaacagcgctggtacgaggaggaggagccccag
ctgcgctgtggtcctgtgcactacagcccagaggaaggcatccactgcgcagctgaaaca
ggaggccccaaaccagcttag

KEGG   Rattus norvegicus (rat): 685679
Entry
685679            CDS       T01003                                 

Gene name
Nme4
Definition
(RefSeq) nucleoside diphosphate kinase, mitochondrial
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    685679 (Nme4)
   00240 Pyrimidine metabolism
    685679 (Nme4)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    685679 (Nme4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    685679 (Nme4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     685679 (Nme4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    685679 (Nme4)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 685679
NCBI-ProteinID: NP_001102948
RGD: 1591334
Ensembl: ENSRNOG00000050424
UniProt: D3ZMT9
LinkDB
Position
10
AA seq 185 aa
MGCLFDRAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIHRFE
RRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGHNVVHISRA
MIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIELWFQSSELLNWADGGHHS
SCYPA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgggttgcttgttcgatcgcgccgcgctgcgggcgctgttgtgcgggccacgctttcag
tgcctgctggtgcgccccagttccggagggcccccctggccccaagagcggaccctggtt
gctgtgaagccagatggggtacagaggaggctagtggggactgtgatacaccgctttgag
aggcggggcttcaagctggtggggatgaagatgttgcaggcaccagagagcatccttgct
gagcactaccgggacctacagaggaagccattctacccagccctcatcagctacatgagc
tctgggccagtggtggccatggtctgggaaggccacaatgtggtccacatctcaagggcc
atgataggacacacggactcaacagaggcagcccctgggacaatcaggggcgacttcagt
gttcacatcagcaggaatgtcattcatgctagcgattccgtggacggggcccagagggag
atcgagctatggtttcagagcagcgaactattgaactgggcagacggtggtcaccacagc
agctgctaccctgcctga

KEGG   Rattus norvegicus (rat): 83782
Entry
83782             CDS       T01003                                 

Gene name
Nme2
Definition
(RefSeq) nucleoside diphosphate kinase B
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    83782 (Nme2)
   00240 Pyrimidine metabolism
    83782 (Nme2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    83782 (Nme2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83782 (Nme2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     83782 (Nme2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    83782 (Nme2)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 83782
NCBI-ProteinID: NP_114021
RGD: 619877
Ensembl: ENSRNOG00000002671
UniProt: P19804
LinkDB
Position
10
AA seq 152 aa
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFKPEELIDYKSCAHDWVYE
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccaacctcgagcgtaccttcattgccatcaagccagatggcgtgcagcgcggcctg
gtgggcgagatcatcaagcgattcgagcagaaggggttccgcctggtggccatgaagttc
cttcgggcttctgaggaacacctgaagcagcactatattgacctgaaagaccgtcctttc
ttcccggggctggtgaagtacatgaactcagggcctgtggtggccatggtctgggagggg
ctcaatgtggtgaaaacaggccgagtgatgctgggggagaccaatccagctgattcgaag
ccaggcaccattcgtggggatttctgcattcaagttggcaggaacatcattcacggcagt
gattcagtggagagtgccgagaaagagatcggtctatggtttaagcccgaagaactgatt
gactataagtcttgtgcccatgactgggtgtatgagtag

KEGG   Rattus norvegicus (rat): 85269
Entry
85269             CDS       T01003                                 

Gene name
Nme3
Definition
(RefSeq) nucleoside diphosphate kinase 3 precursor
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    85269 (Nme3)
   00240 Pyrimidine metabolism
    85269 (Nme3)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    85269 (Nme3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    85269 (Nme3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     85269 (Nme3)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    85269 (Nme3)
SSDB
Motif
Pfam: NDK Amidohydro_2
Other DBs
NCBI-GeneID: 85269
NCBI-ProteinID: NP_445959
RGD: 619879
Ensembl: ENSRNOG00000015749
UniProt: Q99NI1
LinkDB
Position
10
AA seq 169 aa
MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYVELRERPFYSRLVKYMGSGPVVAMVWQGLDVVRASRALIGATDPGDATPGT
IRGDFCVEVGKNVIHGSDSVESAQREIALWFREDELLCWEDSAGHWLYE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatctgtctggtgctgaccatctttgctaacctcttcccctcagcctacagcggcgtg
aacgagcgcacgttcttggcagtgaagcccgacggcgtgcagcggcggctggtgggcgag
atcgtgcgtcgctttgaaaggaagggcttcaagctggtggcactgaagctagtgcaggcc
tccgaagagctactgcgggagcattatgtcgagctgcgggagagacctttctacagccga
ttagttaaatacatgggctctggtcccgtggtggccatggtgtggcaagggctggatgtc
gtgcgcgcttcgcgggccctcataggggccactgacccaggggacgccacgcccggtacg
atccgtggtgatttctgtgtggaggttggcaagaatgtgattcatggcagtgattcggtg
gaaagtgctcagagagagatcgctctttggttccgtgaggatgagcttctgtgctgggag
gacagcgcgggacactggctatatgagtag

DBGET integrated database retrieval system