KEGG   Rattus norvegicus (rat): 24183
Entry
24183             CDS       T01003                                 

Gene name
Ak1
Definition
(RefSeq) adenylate kinase isoenzyme 1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24183 (Ak1)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    24183 (Ak1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24183 (Ak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     24183 (Ak1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24183 (Ak1)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Thymidylate_kin dNK AAA_22 Cytidylate_kin Zeta_toxin AAA_19 NTPase_1 CPT
Other DBs
NCBI-GeneID: 24183
NCBI-ProteinID: NP_077325
RGD: 2076
UniProt: P39069
LinkDB
Position
3
AA seq 194 aa
MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSI
MEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVD
TVFSQVCTYLDSLK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggaagacaagctgaagaaggccaagatcatcttcgtggtgggcgggcctggctcagga
aaaggtacccagtgtgagaagattgtgcagaaatatggctacacccacctctctactggg
gacctgcttcgggcagaagtcagctctggatcgtcgaggggcaagatgctgtcatctatc
atggagaagggagagctggtgccactggagacggtgctggacatgcttcgggatgctatg
ttagccaaagtggactcttccaacggcttcttgattgacggctacccgagggaggtgaaa
cagggagaagagtttgaacggaagatcgcacagcccacactgctactgtatgtggacgca
ggccccgagaccatgacccaacgactcctaaagcgaggggagaccagtggccgtgtggac
gataacgaggagaccatcaagaagaggctggagacgtattacaaagccacagaacctgtc
atctccttctatgacaaacgcggcattgtgcgcaaggtcaatgctgaaggctcagtggac
actgtcttctcccaggtctgcacctatcttgactccctgaagtaa

KEGG   Rattus norvegicus (rat): 24184
Entry
24184             CDS       T01003                                 

Gene name
Ak2
Definition
(RefSeq) adenylate kinase 2, mitochondrial isoform b
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24184 (Ak2)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    24184 (Ak2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24184 (Ak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     24184 (Ak2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24184 (Ak2)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 Cytidylate_kin AAA_18 AAA_28
Other DBs
NCBI-GeneID: 24184
NCBI-ProteinID: NP_001029139
RGD: 2077
Ensembl: ENSRNOG00000000122
UniProt: P29410 A0A0G2JSG6
LinkDB
Position
5
AA seq 232 aa
MAPNALAPEPEHPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATS
NT seq 699 nt   +upstreamnt  +downstreamnt
atggctcccaacgcgttggctcctgaaccggagcatccgaagggcatccgggccgtgttg
ctggggcctcccggggctggcaaggggacccaggcacccaaattggctgagaatttctgt
gtctgtcacttggccactggggacatgctgagagcgatggtagcttcaggctcggagctg
gggaaaaagctgaaggcgacaatggatgccggaaaactggtgagtgatgaaatggtcgtg
gagctcattgagaagaatttggagactccttcctgcaaaaatggctttcttctagatggc
ttccctcggactgtgaagcaggctgaaatgcttgatgacctcatggataagaggaaagag
aagctcgattcagtcatcgagttcagcatccaggactccctgctgatccggagaatcacg
ggaaggctgattcaccccaagagtggccggtcctaccatgaggagttcaaccctccaaag
gaggccatgaaagatgatatcactggggagcccctgatccgcaggtcagatgacaacgag
aaagccttgaagacccgcctggaggcctaccacactcagaccactccgcttgtggaatac
tacaggaaacggggcattcactgcgccattgatgcgtcccagacccctgacgtggtgttt
gcaagcatcctggcagccttctccaaagccacatcctag

KEGG   Rattus norvegicus (rat): 29223
Entry
29223             CDS       T01003                                 

Gene name
Ak4
Definition
(RefSeq) adenylate kinase 4, mitochondrial
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    29223 (Ak4)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    29223 (Ak4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29223 (Ak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     29223 (Ak4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29223 (Ak4)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Cytidylate_kin AAA_33 Thymidylate_kin AAA AAA_28 AAA_16 AAA_22 NTPase_1 ABC_tran AAA_5
Other DBs
NCBI-GeneID: 29223
NCBI-ProteinID: NP_058831
RGD: 2078
Ensembl: ENSRNOG00000045738
UniProt: Q9WUS0
LinkDB
Position
5
AA seq 223 aa
MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTNTEVGDVAKQYLEK
GLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDRICDVDLVISLNIPFETLK
DRLSRRWIHPSSGRVYNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAARLRRYKDAAKP
VIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcttccaaactcctgcgcgcagtcatcctggggccgcctggctctggcaagggcacg
gtatgcgaaaggatcgcccagaactttggcctccagcatctctccagcggccacttgttg
cgggagaacctaaagaccaacacggaagttggtgacgtggcaaaacagtacctagaaaaa
ggtcttttggttccggaccatgtgatcacgcgcctaatgatgtcagaactggagacccgg
agtgcccagcactggctattagatggattcccaaggacattagtgcaggcagaagctctg
gacagaatctgtgatgtggacctagtaatcagtttgaatattcctttcgagacacttaaa
gatcgtctgagccgacggtggattcacccttccagcgggagggtctataacctagacttc
aacccacctcaagtgctgggggttgatgacatcaccggcgagcctcttgtccaacaggaa
gatgataaacctgaagcacttgctgcccggctaagacggtacaaggacgcagcaaaacca
gtcatcgaactgtacaagagccgtggagtgctccaccagttttctgggacggagactaac
agaatctggccttatgtttacacgctcttctccaacaagatcacacccattcaatccaaa
gaagcctactga

KEGG   Rattus norvegicus (rat): 301115
Entry
301115            CDS       T01003                                 

Definition
(RefSeq) adenylate kinase isoenzyme 1-like isoform X1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    301115
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    301115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    301115
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     301115
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   301115
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 CoaE Thymidylate_kin Zeta_toxin AAA AAA_28 AAA_22 Cytidylate_kin
Other DBs
NCBI-GeneID: 301115
NCBI-ProteinID: XP_017452195
RGD: 1588584
LinkDB
Position
9
AA seq 212 aa
MGLCESTLPQLGRALRPQEKDILRYPLIIFVVGGPGCGKGTQCRNMAMKYGFYHVELGQL
LREEAQRSTQRGRQIRDIMQQGLLVPTGLILDMVSDNLLSYPKSRGFLVDGFPRELEQAK
EFERIVGRAPNIVIVFDCSMETMVRRVLRRGQVEHRADDSELAIRKRLETHYTLCEPVLT
FYQQKNLLRNILAEGAPESIFAKCCSVIESLQ
NT seq 639 nt   +upstreamnt  +downstreamnt
atgggtctgtgcgagtccacgctgccccagctgggcagagctttacggccccaggagaag
gacatcctgaggtatcctctgatcatctttgtggtgggggggcctggctgcgggaaaggg
acccagtgcagaaacatggctatgaaatacggcttctaccacgtggagctgggccagctg
ctgcgggaggaggctcagagaagcacccagaggggccggcagatccgggacatcatgcag
cagggactcctggtacccacgggtctcattctggacatggtcagtgacaacttgttgtct
tatccaaagagccgcggctttctcgtcgatggcttccccagagagctggaacaggccaaa
gagtttgagcggattgtgggcagggcccccaacatagtcatagtgtttgactgctccatg
gagaccatggtgcgcagagtgctacgacgaggacaggtggagcaccgggcagatgattca
gagctggccatccgcaagcgcctagagacacactacaccctatgtgagcccgtcctgacc
ttttaccagcaaaagaaccttctgagaaatatattagctgaaggagcccctgaaagcatc
ttcgccaagtgctgttcagtcattgagagtctgcagtga

KEGG   Rattus norvegicus (rat): 311833
Entry
311833            CDS       T01003                                 

Gene name
Ak8
Definition
(RefSeq) adenylate kinase 8
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    311833 (Ak8)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    311833 (Ak8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    311833 (Ak8)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     311833 (Ak8)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   311833 (Ak8)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 AAA Hydin_ADK RuvB_N SKI AAA_5 DUF5582 Rad17 AAA_16 KTI12 RNA_helicase SRPRB Cytidylate_kin AAA_14 6PF2K AAA_28 PPV_E1_C DUF5586 TIP49 APS_kinase
Other DBs
NCBI-GeneID: 311833
NCBI-ProteinID: NP_001004266
RGD: 1303144
Ensembl: ENSRNOG00000012761
UniProt: Q68FP8
LinkDB
Position
3
AA seq 479 aa
MDATSAPHRIPPEMPQYGEDYHIFEMMQSMLEQLLIHQPEDPISFMISHLRRNNDNVPRV
VILGPPASGKTTIAMWLCKHLNSNLITKENLLEREFSLLSLEAKKHYQVYKRVPNSTLVS
LVQERLNEDDCLRRGWILDGIPERREQALMIQTLGLAPKHVIVLSAPDSVLIERNVGKRI
DPVTGEIYHTTFDWPPELEIQNRLIQPEGISEIDTAKKLLEYHRHIIRILPSYPKILKTI
SSDQPCVDVFYQALTYVQSGHRCNAPFTPKVLLCGPMGCGKKLQAALLSQKYGLVNISCG
QLLKEAMAAESSLGDLIEPFFEKRMTVPDSIITRVLTERLKQQDCIQKGWVLHGFPRDLD
QARLLNSMGYSPNRVFFLNVPLDSILERLTLRRTDPVTGERFHLMYKPPPTIEVQARLLQ
NPKDSEEYIKLQTDLFYRNSGDLEQYYDRAIIVNGDQDPYTVFEYIESGIINPLPRKVT
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatgctacctcggccccgcaccgcatccccccagaaatgcctcagtacggggaagac
taccacatcttcgagatgatgcagagcatgctggagcagctcctgattcaccagccagag
gaccccatcagcttcatgatcagtcaccttcgcaggaacaacgataatgtgccgagagtt
gtgatattaggtccgcctgcctcagggaaaaccaccatcgcgatgtggctctgcaaacat
ctgaacagcaacctcatcaccaaggagaacttattagagagagagttttccctcctgtct
ctggaagccaagaaacactaccaggtttacaagagagtgcccaattcgactcttgtcagc
ctggtccaggagcgtctgaatgaggatgactgcctcagaaggggctggatcctggatggc
atccccgagaggcgggagcaggctctgatgatccagaccctgggactggcacccaagcac
gtcatcgtgcttagcgctccagactccgtcctgatcgagagaaatgtggggaaacggatt
gatcctgtcactggagagatctatcacaccaccttcgactggccccctgagcttgaaata
cagaacaggctgatacagccagaaggcatctcggagatagacacagcgaagaagctgctg
gaataccacaggcacatcatcaggattcttccttcctaccctaaaatcctgaaaactatc
agctcagaccagccatgtgtggatgtcttctaccaggctctgacctacgtccaatctggc
caccgatgtaatgccccgttcacccccaaggtgctgctgtgtgggccaatgggctgtggg
aagaaactgcaggctgcccttctgtcccagaaatatggcctcgtgaacatcagctgcggg
cagctgctgaaggaagctatggcagccgaatcgagccttggggacctcatagaaccattc
tttgaaaagaggatgacagttccagacagtatcatcaccagagttctgactgagcgtctg
aagcaacaagattgcatccagaaagggtgggtgctgcacggcttcccaagagacctggac
caggcccggctgctgaactctatgggctacagtcccaacagggtgttcttcctgaatgtg
ccgttggattccatcctggagcggctcacactgagaaggacagaccctgtcacaggagaa
aggttccatctcatgtacaagccccctcccaccatagaggtccaggctcgcctcctgcag
aaccccaaggattcagaggagtacatcaagctccaaacggacttgttctataggaactct
ggggacctggagcagtactacgatcgggccatcattgtcaacggtgaccaggacccatac
acagtttttgagtatatagagagtggaatcattaatcctctgcccaggaaagttacctga

KEGG   Rattus norvegicus (rat): 314416
Entry
314416            CDS       T01003                                 

Gene name
Ak7
Definition
(RefSeq) adenylate kinase 7
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    314416 (Ak7)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    314416 (Ak7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    314416 (Ak7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     314416 (Ak7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   314416 (Ak7)
SSDB
Motif
Pfam: Dpy-30 ADK AAA_18 AAA_17 6PF2K Hydin_ADK GBP_C RIIa AAA_16
Other DBs
NCBI-GeneID: 314416
NCBI-ProteinID: NP_001101525
RGD: 1309600
Ensembl: ENSRNOG00000055714
UniProt: A0A0G2JZ71
LinkDB
Position
6
AA seq 724 aa
MAEEEVPATTEKVLKIQRVFINHLDTYSSGNIGKFLANCVAGASLEEIGEEEEEEDETKS
AGAATEATTTKVKEGTFQIVGTLAKLESTRPDFAVETYSHGTSREDLLARLLECDVVVYN
ITENAQQVQEALWAVSALSEEISHFEKRKMFILLSTVMTWARSKPLDPDDSEVPFTEEDY
RRRKHHPNFQDHINAEKLVLKFGKNAKKFVTYVVASGLQYGVEGGILHAFFKMAWLGEIP
ALPVFGDGSNCIPAIHVLDLAGVIQNVIDHVPKLHYLVAVDESVHTLEDLVKCISKNTGP
GKIQKVPKENAFLTKDLTQEHLDQLLVNLRMEALFVKENFNIRWAAQTGFVENIGSILKE
YKQSRGLLPIKICILGPPAVGKSSISGELVKYYKLHHIKIKDVISEAIAKLEAIVAPKES
TEEEEGEEEEEEENVEDAQELLDGIKESMEQNAGRLEDQYVIRFVKEKLKSMPCKNQGYV
LDGFPKTYDQAKDLFNQEDEEEEEEVRGKMFPYDKLITPEFVCNLDASDEFLKERVMNLP
ESVVAGTHYSQDRFLRALSNYRDINTDDETVFNYFDEIEIHPIHIDVGKLEDAQNRLAIK
QLIKEIGEPRNYGLTDEEKAEVEKKAAEERLAKEAAQTAEREHKEALEMAEKIARWEEWS
KRLEEVKREERELLEAQSIPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFKNN
PEMQ
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggctgaagaggaagttcctgcgacgaccgaaaaagttctgaaaatacagagggtgttc
ataaaccatctggacacctatagcagcggaaacataggaaagttcctagctaactgtgtc
gccggggcttcactggaagagattggagaagaggaagaggaagaggatgagaccaagtca
gcgggagctgctacagaagctaccaccacaaaagtgaaggaaggcaccttccagattgtg
ggcaccttagccaagctggagagcaccaggccggacttcgctgtggaaacctactcccat
ggcacctcccgggaggacctgctcgcgcgtctcttggagtgtgacgttgtcgtctataac
atcacggagaatgcacagcaagtgcaggaagccttgtgggcagtctccgcactgagtgaa
gaaatcagccattttgaaaagcgaaagatgttcattttgttgtcgacagtgatgacatgg
gcgagatccaaacccctggaccctgatgatagcgaggttcccttcaccgaagaggattat
cggcgaaggaaacatcaccccaacttccaggaccacatcaacgccgaaaaactagtcctc
aagtttggaaagaatgccaaaaagtttgtaacttatgtagtcgcctcaggacttcagtat
ggagtggaaggaggcatcttacacgcattttttaagatggcctggctcggagagattcct
gcattaccggtgtttggagacgggagcaattgcattccagccattcacgttcttgaccta
gcaggagtgatccagaacgtcatagaccacgtgcctaagcttcactacctggtggctgtg
gacgagtctgtccacaccctggaagacctggtcaagtgcatcagcaaaaataccggccct
ggaaaaatccagaaagtacccaaagaaaatgctttcctgacaaaggacttaacgcaagag
catctggaccaattgctggtcaacctgaggatggaagccctctttgtgaaggagaacttt
aacatccgctgggccgcccagacgggattcgtggagaacatcggcagcatcctcaaagag
tacaagcagagccgaggactgttgccaatcaagatctgcattcttggtcctcctgctgtg
ggaaaatccagcatctctggagagctggtcaagtactacaaactgcaccacatcaagata
aaggatgtgatttccgaagccatagccaaactggaggcgattgtcgcacccaaggagtca
acggaagaagaggaaggtgaagaagaggaggaggaagagaacgtggaggacgcccaggaa
ctccttgatggcatcaaggaaagcatggagcagaacgcaggtcggctagaagaccaatat
gtaattcgatttgtgaaagaaaagctcaaatctatgccttgtaagaaccaaggttacgtt
ttggatggcttcccaaagacctatgatcaagcgaaagacctgttcaaccaggaagatgaa
gaggaagaagaggaagtcagaggcaaaatgtttccctatgataaactaattacacctgaa
tttgtgtgcaacctggacgcctctgatgagtttctgaaggagcgcgtgatgaacctccca
gagagtgtcgtggcgggaactcactacagccaggaccgattcctccgggctctgagcaac
taccgggacatcaacacagatgacgagacggtcttcaactactttgatgaaattgaaatt
caccccatacatattgacgtaggaaaacttgaagatgcccagaacaggcttgctatcaaa
cagctcatcaaagagattggggagcctcggaattatggcttaacagatgaagaaaaggca
gaggtggagaagaaagctgcagaggaacgcctggccaaggaggctgctcagacggcagaa
cgtgagcacaaggaggccctggagatggcggagaagatagcccgctgggaggagtggagt
aaacggctggaggaagtgaagcgagaagagagggagctgctggaggcgcagtccatcccc
ctgagaaactacctgatgacctacgtgatgcctaccctcatgcaggggctcaatgagtgc
tgcaaggtgagacccgaagaccccgtggattttctggccgagtatctcttcaagaacaat
cccgaaatgcagtaa

KEGG   Rattus norvegicus (rat): 365985
Entry
365985            CDS       T01003                                 

Gene name
Ak5
Definition
(RefSeq) adenylate kinase isoenzyme 5
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    365985 (Ak5)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    365985 (Ak5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    365985 (Ak5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     365985 (Ak5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   365985 (Ak5)
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Cytidylate_kin Thymidylate_kin Zeta_toxin AAA_28 dNK AAA_22 Hydin_ADK AAA AAA_19 SRP54 AAA_16 Cytidylate_kin2 Dpy-30
Other DBs
NCBI-GeneID: 365985
NCBI-ProteinID: NP_001102421
RGD: 1590818
Ensembl: ENSRNOG00000046947
UniProt: M0R7U1
LinkDB
Position
2
AA seq 562 aa
MNTNEAKEYLARRDIPQLFESLLNGLMCSKPEDPIEYLETCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPSRPRPKIILVIGGPGSGKGTQSLKIAERYGFQCISVGELLRKKIHSASSNRKW
SLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDA
DRDEDAVFHDISMAVDNKLFPNKEAPTDSSDLDPSMMFDAGEIVDTGSDYDNQDDDQLNV
FGEDTMGGFVEDLRKCKIIFLMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESE
RSKLIRDIMERGDLVPSGVVLELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGEP
QLVICMDCSADTMTNRLLQRSQSSQRGEDSAKSVAKRLEAYHRASIPVIAYYETKTQLQK
VNAEGTPDQVFLQLCTAIDSVF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaacaccaacgaagccaaggagtacctggcccggagggacattcctcagcttttcgag
agcctgctgaacggcttgatgtgttccaagccagaagaccccatagagtacttggaaact
tgtttacagaaagtcaaggagctcggaggctgtgacaaggtgaagtgggacacattcgtc
agccaggaaaagaagacgctaccaccgctaaatggaggacaatcacgaagatccttcctc
cgaaatgtcatgcctgaaaattcaaactttccctatcgacggtatgaccggctccctcca
atccatcagttttccatagagagcgacacggacctgtctgagaccgcagagctgatagaa
gagtatgaggtctttgacccatccaggcctcggcccaaaatcattcttgtcataggtggt
ccaggaagtggaaaggggactcagagtttgaagatcgcagagcggtatggattccagtgc
atttcagtgggagaattactgaggaagaaaatccacagtgccagcagcaacagaaaatgg
agcctgatcgctaagattatcaccaacggggagctggccccacaggagacgacaatcacg
gagataaaacaaaaactgatgcaaatacctgatgaggaaggcattgttattgatggattc
ccaagagatgttgcccaggctctgtcttttgaggaccagatctgcacccctgacctggtg
gtgttcctggcttgtgccaaccagaggctcaaggagagattacagaagcgtgcggagcag
caggggcggccggatgacaacctgaaagccacccaaaggagactagtgaacttcaagcag
aacgccgcgccgctagtgaagtacttccaggagaaggggctcatcgtgactttcgatgct
gaccgagatgaagacgcagtgttccatgacatcagcatggccgtcgacaacaagttattt
ccaaacaaagaggctccgacagattcaagtgaccttgacccttccatgatgtttgatgct
ggagagattgttgacacaggatcggattatgacaaccaggatgatgatcagctaaatgta
tttggagaagacaccatgggaggcttcgtggaggatttgaggaagtgtaaaattattttc
ctgatgggtggccctggctctggcaaaggcacccagtgtgagaagctggcagaaaaatat
gggttcacccatctctctactggtgagctgctgcgccaggagctgacctcggagtccgaa
agaagcaaactgatccgtgacatcatggagcgtggagatctggtgccctcgggtgtcgtc
ctggagctgctgaaggaggccatggtggccagcctgggcaacaccaagggcttcctgatt
gacggctacccccgggaagtgaagcaaggggaagagtttggacgaaggatcggagagcca
caactggtgatctgcatggactgctcagcagacaccatgactaaccgccttctgcagaga
agccagagcagccagcgtggggaggacagtgccaagagcgttgccaaacgcctggaggct
taccaccgagcgtccatccctgtcatcgcctactacgagacgaaaacacagctacagaag
gtaaacgcagagggaacaccagatcaagtttttcttcagctctgcacagctattgactct
gttttctga

DBGET integrated database retrieval system