KEGG   Rattus norvegicus (rat): 24335
Entry
24335             CDS       T01003                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24335 (Epo)
   04066 HIF-1 signaling pathway
    24335 (Epo)
   04151 PI3K-Akt signaling pathway
    24335 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24335 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24335 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24335 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24335 (Epo)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   24335 (Epo)
SSDB
Motif
Pfam: EPO_TPO AraC_N
Other DBs
NCBI-GeneID: 24335
NCBI-ProteinID: NP_058697
RGD: 2559
Ensembl: ENSRNOG00000001412
UniProt: P29676
LinkDB
Position
12q12
AA seq 192 aa
MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgcttttactatccttgctactgattcctctg
ggcctcccagtcctctgcgctcccccacgcctcatttgcgacagtcgcgttctggagagg
tacatcttggaggccaaggaggcagaaaatgtcacaatgggctgtgcagaaggtcccaga
ctgagtgagaatattaccgtcccagataccaaagtcaacttctacgcttggaaaagaatg
aaggtggaagaacaggctgtagaagtttggcaaggcctgtctctgctctcagaagccatc
ctgcaggcccaggctctgcaggccaattcctcccagccaccagagagtcttcagcttcat
atagacaaagccatcagtgggctacgtagcctcacttcactgcttcgggtgctgggagct
cagaaggaattgatgtcgcctccagacgccacccaagccgctccactccgaacactcaca
gcggatactttctgcaagctcttccgggtctactccaacttcctccgggggaaactgaag
ctgtacacgggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system