KEGG   Rattus norvegicus (rat): 24337Help
Entry
24337             CDS       T01003                                 

Gene name
Erbb2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24337 (Erbb2)
   04012 ErbB signaling pathway
    24337 (Erbb2)
   04066 HIF-1 signaling pathway
    24337 (Erbb2)
   04020 Calcium signaling pathway
    24337 (Erbb2)
   04151 PI3K-Akt signaling pathway
    24337 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24337 (Erbb2)
   04520 Adherens junction
    24337 (Erbb2)
   04530 Tight junction
    24337 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24337 (Erbb2)
   05206 MicroRNAs in cancer
    24337 (Erbb2)
   05205 Proteoglycans in cancer
    24337 (Erbb2)
   05230 Central carbon metabolism in cancer
    24337 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    24337 (Erbb2)
   05226 Gastric cancer
    24337 (Erbb2)
   05219 Bladder cancer
    24337 (Erbb2)
   05215 Prostate cancer
    24337 (Erbb2)
   05213 Endometrial cancer
    24337 (Erbb2)
   05224 Breast cancer
    24337 (Erbb2)
   05223 Non-small cell lung cancer
    24337 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24337 (Erbb2)
   01524 Platinum drug resistance
    24337 (Erbb2)
   01522 Endocrine resistance
    24337 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24337 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24337 (Erbb2)
   04090 CD molecules [BR:rno04090]
    24337 (Erbb2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24337 (Erbb2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   24337 (Erbb2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   24337 (Erbb2)
CD molecules [BR:rno04090]
 Proteins
  24337 (Erbb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 24337
NCBI-ProteinID: NP_058699
RGD: 2561
Ensembl: ENSRNOG00000006450
UniProt: Q8K3F9
LinkDB All DBs
Structure
PDB: 

Position
10q31
AA seq 1259 aa AA seqDB search
MIIMELAAWCRWGFLLALLPPGIAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQ
GNLELTYVPANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVL
DNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKN
NQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCC
HEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCV
TTCPYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLRGARAI
TSDNVQEFDGCKKIFGSLAFLPESFDGDPSSGIAPLRPEQLQVFETLEEITGYLYISAWP
DSLRDLSVFQNLRIIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNAHLCF
VHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSHFLR
GQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSEADQCAACAHYKDSSSC
VARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIA
TVVGVLLFLILVVVVGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILK
ETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAG
VGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYL
EDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILR
RRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMV
KCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGD
LVDAEEYLVPQQGFFSPDPTPGTGSTAHRRHRSSSTRSGGGELTLGLEPSEEGPPRSPLA
PSEGAGSDVFDGDLAMGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQ
PEYVNQSEVQPQPPLTPEGPLPPVRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEY
LVPREGTASPPHPSPAFSPAFDNLYYWDQNSSEQGPPPSNFEGTPTAENPEYLGLDVPV
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcatggagctggcggcctggtgccgctgggggttcctcctcgccctcctgccc
cccggaatcgcgggcacccaagtgtgtaccggcacagacatgaagttgcggctccctgcc
agtcctgagacccacctggacatgctccgccacctgtaccagggctgtcaggtagtgcag
ggcaacttggagcttacctacgtgcctgccaatgccagcctctcattcctgcaggacatc
caggaagttcagggttacatgctcatcgctcacaaccaggtgaagcgcgtcccactgcaa
aggctgcgcatcgtgagagggacccagctctttgaggacaagtatgccctggctgtgcta
gacaaccgagatcctcaggacaatgtcgccgcctccaccccaggcagaaccccagagggg
ctgcgggagctgcagcttcgaagtctcacagagatcctgaagggaggagttttgatccgt
gggaaccctcagctctgctaccaggacatggttttgtggaaggacgtcttccgcaagaat
aaccaactggctcctgtcgatatagacaccaatcgttcccgggcctgtccaccttgtgcc
cccgcctgcaaagacaatcactgttggggtgagagtccggaagactgtcagatcttgact
ggcaccatctgtaccagtggttgtgcccggtgcaagggccggctgcccactgactgctgc
catgagcagtgtgccgcaggctgcacgggccccaagcattctgactgcctggcctgcctc
cacttcaatcatagtggtatctgtgagctgcactgcccagccctcgtcacctacaacaca
gacacctttgagtccatgcacaaccctgagggtcgctacacctttggtgccagctgcgtg
accacctgcccctacaactacctgtctacggaagtgggatcctgcactctggtgtgtccc
ccgaataaccaagaggtcacagctgaggacggaacacagcgttgtgagaaatgcagcaag
ccctgtgctcgagtgtgctatggtctgggcatggagcaccttcgaggggcgagggccatc
accagtgacaatgtccaggagtttgatggctgcaagaagatctttgggagcctggcattt
ttgccggagagctttgatggggacccctcctccggcattgctccgctgaggcctgagcag
ctccaagtgttcgaaaccctggaggagatcacaggttacctgtacatctcagcatggcca
gacagtctccgtgacctcagtgtcttccagaaccttcgaatcattcggggacggattctc
cacgatggcgcgtactcattgacactgcaaggcctggggatccactcgctggggctgcgc
tcactgcgggagctgggcagtggattggctctgattcaccgcaacgcccatctctgcttt
gtacacactgtaccttgggaccagctcttccggaacccacatcaggccctgctccacagt
gggaaccggccggaagaggattgtggtctcgagggcttggtctgtaactcactgtgtgcc
cacgggcactgctgggggccagggcccacccagtgtgtcaactgcagtcatttccttcgg
ggccaggagtgtgtggaggagtgccgagtatggaaggggctcccccgggagtatgtgagt
gacaagcgctgtctgccgtgtcaccccgagtgtcagcctcaaaacagctcagagacctgc
tttggatcggaggctgatcagtgtgcagcctgcgcccactacaaggactcgtcctcctgt
gtggctcgctgccccagtggtgtgaaaccggacctctcctacatgcccatctggaagtac
ccggatgaggagggcatatgccagccgtgccccatcaactgcacccactcctgtgtggat
ctggatgaacgaggctgcccagcagagcagagagccagcccggtgacattcatcattgca
actgtagtgggcgtcctgctgttcctgatcttagtggtggtcgttggaatcctaatcaaa
cgaaggagacagaagatccggaagtatacgatgcgtaggctgctgcaggaaactgagtta
gtggagccgctgacgcccagcggagcaatgcccaaccaggctcagatgcggatcctaaaa
gagacggagctaaggaaggtgaaggtgcttggatcaggagcttttggcactgtctacaag
ggcatctggatcccagatggggagaatgtgaaaatccccgtggctatcaaggtgttgaga
gaaaacacatctcctaaagccaacaaagaaattctagatgaagcgtatgtgatggctggt
gtgggttctccgtatgtgtcccgcctcctgggcatctgcctgacatccacagtacagctg
gtgacacagcttatgccctacggctgccttctggaccatgtccgagaacaccgaggtcgc
ctaggctcccaggacctgctcaactggtgtgttcagattgccaaggggatgagctacctg
gaggacgtgcggcttgtacacagggacctggctgcccggaatgtgctagtcaagagtccc
aaccacgtcaagattacagatttcgggctggctcggctgctggacattgatgagacagag
taccatgcagatgggggcaaggtgcccatcaaatggatggcattggaatctattctcaga
cgccggttcacccatcagagtgatgtgtggagctatggagtgactgtgtgggagctgatg
acttttggggccaaaccttacgatggaatcccagcccgggagatccctgatttgctggag
aagggagaacgcctacctcagcctccaatctgcaccattgatgtctacatgattatggtc
aaatgttggatgattgactctgaatgtcgcccgagattccgggagttggtgtcagaattt
tcacgtatggcgagggacccccagcgttttgtggtcatccagaacgaggacttgggccca
tccagccccatggacagtaccttctaccgttcactgctggaagatgatgacatgggtgac
ctggtagacgctgaagagtatctggtgccccagcagggattcttctccccggaccctacc
ccaggcactgggagcacagcccatagaaggcaccgcagctcgtccaccaggagtggaggt
ggtgagctgacactgggcctggagccctcggaagaagggccccccagatctccactggct
ccctcggaaggggctggctccgatgtgtttgatggtgacctggcaatgggggtaaccaaa
gggctgcagagcctctctccacatgacctcagccctctacagcggtacagcgaggacccc
acattacctctgccccccgagactgatggctatgttgctcccctggcctgcagcccccag
cccgagtatgtgaaccaatcagaggttcagcctcagcctcctttaaccccagagggtcct
ctgcctcctgtccggcctgctggtgctactctagaaagacccaagactctctctcctggg
aagaatggggttgtcaaagacgtttttgccttcgggggtgctgtggagaaccctgaatac
ttagtaccgagagaaggcactgcctctccgccccacccttctcctgccttcagcccagcc
tttgacaacctctattactgggaccagaactcatcggagcaggggcctccaccaagtaac
tttgaagggacccccactgcagagaaccctgagtacctaggcctggatgtacctgtatga

DBGET integrated database retrieval system