KEGG   Rattus norvegicus (rat): 24380Help
Entry
24380             CDS       T01003                                 

Gene name
Gad2, gad65
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00250  Alanine, aspartate and glutamate metabolism
rno00410  beta-Alanine metabolism
rno00430  Taurine and hypotaurine metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
rno04727  GABAergic synapse
rno04940  Type I diabetes mellitus
Module
rno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    24380 (Gad2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24380 (Gad2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    24380 (Gad2)
   00430 Taurine and hypotaurine metabolism
    24380 (Gad2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    24380 (Gad2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    24380 (Gad2)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     24380 (Gad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase COG7
Motif
Other DBs
NCBI-GeneID: 24380
NCBI-ProteinID: NP_036695
RGD: 2653
Ensembl: ENSRNOG00000018200
UniProt: Q05683
LinkDB All DBs
Position
17q12.3
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDSEKPAESGG
SVTSRAATRKVACTCDQKPCSCPKGDVNYALLHATDLLPACEGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWFVPPSLRVLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtccttcggatctgaagatggctctggggatcct
gagaacccgggaacagcgagagcctggtgccaggtggcccaaaagttcacgggcggcatc
ggaaacaagctatgcgctctgctctacggagactctgagaagccagcagagagcggcggg
agcgtgacctcgcgggccgccactcggaaggtcgcctgcacctgtgaccaaaaaccctgc
agctgccccaaaggagatgtcaattatgcacttctccacgcaacagacctgctgccagcc
tgtgaaggagaaaggcccactctcgcatttctgcaagatgtaatgaacattttgcttcag
tacgtggtgaaaagttttgatagatcaactaaagtgattgatttccattaccccaatgag
cttcttcaagagtataattgggaattggcagaccaaccgcaaaatctggaggaaattttg
acgcactgccaaacaactctaaaatatgcgattaaaacagggcatccccgatattttaat
cagctgtctaccggattggatatggttggattagcagcagattggttgacatcaacagca
aacacgaacatgtttacctatgagatcgcccctgtatttgtactactggaatatgtgaca
ctaaagaaaatgagggaaatcattggctggccaggaggctctggcgatggaatcttttct
cctggtggtgccatctccaacatgtacgccatgctcattgcccgctataagatgtttcca
gaagtcaaggaaaaggggatggcggcggtgcccaggctcatcgcattcacgtcagagcat
agtcacttttctctcaagaagggagctgcagccttggggatcggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgatcccatctgaccttgaaagaagaatcctt
gaagtcaaacagaaaggatttgttcctttcctggtgagtgccacagctggaaccactgtg
tacggggcttttgatcctctcttggctgtagctgacatctgcaaaaaatataagatctgg
atgcatgtggatgctgcttggggtggagggttactgatgtctcggaaacacaagtggaag
ctgaacggtgtggagagggccaactctgtgacatggaatccccacaagatgatgggtgtc
cccttgcaatgttcggctctcctggtcagagaggagggactgatgcagagctgcaaccag
atgcatgcttcctacctctttcagcaagataagcactatgacctgtcctatgacacggga
gacaaggccttgcagtgtggacgccacgtcgatgtctttaaattatggctcatgtggaga
gcaaaggggactactggatttgaagctcacattgataagtgtttggagctggcagagtat
ttatacaatatcattaaaaaccgagaaggatatgaaatggtgttcgatgggaagcctcag
cacacaaatgtctgcttctggtttgtacctcctagtttgcgagttctggaagacaatgaa
gagagaatgagccgcctctcaaaggtggcgccagtgattaaagccagaatgatggagtat
gggaccacaatggtcagctaccaacccttaggagataaggtcaacttcttccgcatggtc
atctcaaaccctgcagcaactcaccaagacattgacttcctcattgaagaaatcgaacgc
ctgggacaagatttgtaa

DBGET integrated database retrieval system