KEGG   Rattus norvegicus (rat): 24382Help
Entry
24382             CDS       T01003                                 

Gene name
Ganc
Definition
(RefSeq) glucosidase, alpha; neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    24382 (Ganc)
   00500 Starch and sucrose metabolism
    24382 (Ganc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     24382 (Ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 24382
NCBI-ProteinID: NP_001139312
RGD: 2660
Ensembl: ENSRNOG00000024563
UniProt: D4A7G5
LinkDB All DBs
Position
3q35
AA seq 913 aa AA seqDB search
METPEKKEISVEDEAVDKTIFKDCGKIAFYRRQKQQLSKNTTYRASLGSVSTEQDSTRFQ
ISSEATKIPLVAEVYGIEKDIFRLKINEETPLKPRYEVPDVVNSKLGTVRLVCSGDTGSL
TLTDRKGDLRCHISANPFKIDLLSKDEALISINSLGKLYFEHLRVPHKQRATKGNGQNTP
ADTFQENQEDLGLWEEKFGKFVDVKVNGPSSVGLDFSLHGFEHLYGIPQHAESHQLKNTR
DGDAYRLYNLDVYGYQVHDKMGIYGSVPYLLAHKQGRTVGIFWLNASETLVEINTEPAAE
YTLTQMGPAAAKQKVRCRTNVHWMSESGIIDVFLLTGPTPADIFKQYSYITGTQAMPPLF
SLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEDKKYFTWDKKRFANPKRM
QELLRSKGRKLVVISDPHIKVDPDYTVYAEAKERGFFVKNPEGGDLEGVCWPGLSSYLDF
TNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPELTMQKNAVHHGNWEHRELH
NIYGFYHQMATAEGLIQRSQGKERPFVLSRSFFAGSQKYGAVWTGDNTAEWSYLKISIPM
LLTLSVSGISFCGADVGGFIGNPEAELLVRWYQAAAYQPFFRGHATMNTKRREPWLFGAE
YTQLIREAIRERYSLLPYLYSLFYHAHVSSQPVMRPLWVEFPDDLETFAVEDEYMLGNAL
LVHPVTAPQTTMIDVFLPGSNEVWYNSKTFAYWKGGCAVKVPVTLDTIPVFQRGGSVVPV
KTTVGKSTGWMTDSPYGLRVALNTQGSAVGELYLDDGHSFQYLHQNQFLHRKFLFCSSVL
TNRCADEKGHYPSKCIVEQILVLGLKKKPSSVTTHSSDGKVQPATFAYCAKTCTLSLKKL
SLSVGDDWEVHVS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacctgagaaaaaggaaatcagtgttgaagatgaagcagtggataaaaccatt
ttcaaagactgtggcaagattgcattctacaggcggcagaaacagcagctctccaagaat
accacctaccgggcttcactaggctccgtcagcacagaacaggacagcaccaggttccaa
atcagcagtgaagcaactaagattcctcttgtggctgaagtttatggtatagagaaggac
attttcagacttaagatcaatgaagaaactccactgaaaccaaggtatgaagttcctgat
gtcgtcaacagcaagcttggaactgtcaggctggtctgctcaggggacacaggcagcctg
acactgacagatagaaaaggagatctgagatgtcatatctcagcaaacccattcaagatt
gatttgttgtctaaggacgaggctctgatcagcatcaactccctgggcaagctatacttt
gagcacctgcgggttcctcacaagcagagagctaccaaaggaaatggacaaaatacacca
gctgacacctttcaggaaaatcaagaggacctgggcctgtgggaagagaaatttggaaaa
tttgtggatgtcaaagttaatggcccttcctctgttggtttggatttctcccttcatgga
tttgaacatctctatggtatccctcaacatgcagagtcacaccaacttaaaaatactaga
gatggagacgcataccgtctttataacctagatgtctatggataccaagttcatgacaaa
atgggcatatatggttcagtgccttatctcctggcccacaaacagggcaggactgtaggt
attttctggctgaacgcctcagaaacactagtggagatcaacacagagccagcagctgag
tacacactgacccagatgggcccagcagctgccaaacaaaaagtcaggtgccgaactaat
gtgcactggatgtcagagagtgggatcattgacgtttttctgctgacaggacctacacct
gctgacatcttcaagcagtactcatatatcacaggcacacaagccatgccccctcttttt
tccctggggtaccaccagtgtcgctggaactatgaagatgaacaggatgtgaaggcagtc
gatgcagggtttgatgaacatgacattccatatgatgtcatgtggctggacatagagcac
acggaggacaagaagtacttcacctgggacaaaaagagattcgcaaaccccaaaaggatg
caagagctgctcaggagcaaaggacgcaagcttgtggttatcagtgacccccacatcaag
gtggatcctgactacacagtctatgctgaagccaaagaacggggcttctttgtgaagaat
ccagagggtggcgacttggaaggagtctgttggcctggtctctcgtcttacctggacttc
accaaccccaaggtcagagagtggtattccagcctttttgcttttcctgtctatcaggga
tctacggacatccttttcctatggaatgacatgaatgagccctcagtcttcagagggcca
gagctaaccatgcagaagaatgctgttcatcatggcaactgggaacacagagaacttcac
aacatctacggcttttatcaccaaatggctacggcagaaggattgatacagcgatctcag
gggaaggagaggccctttgttctttcgcgttccttctttgctggatcacaaaagtatggt
gcagtgtggacgggagacaacacagcagaatggagctatctgaaaatctccatccctatg
ttacttaccctcagtgtctcagggatctccttctgtggagctgatgtgggcggcttcatt
ggcaatcctgaagcagagctgctagtgcgctggtaccaggctgcagcttaccagcccttc
ttccgaggccatgctaccatgaacaccaagcggcgagaaccctggctgtttggggcagaa
tacactcagctgatccgggaagccatcagagagcgctacagcctcctgccctatctgtat
tctctgttctaccatgcgcacgtgtcttctcagcctgtcatgaggcccctgtgggtcgaa
tttcctgatgacttagagacttttgctgtggaagatgaatacatgctaggcaatgcttta
ttggttcatccagttacagcaccacagaccaccatgattgatgtcttcctgccagggtca
aatgaggtctggtacaactctaagacatttgcatattggaaaggaggatgtgctgtgaag
gttccagtaaccttggatactatcccagtgtttcaacgaggtggaagtgtggtaccagta
aagactactgtggggaagtccaccggctggatgactgactccccatatgggctccgagtt
gccctaaacactcagggttctgctgtgggagagctgtatctcgatgacggccattcattc
cagtacctccaccagaaccagttcttacaccgcaagttcttattctgctccagtgttctg
accaacaggtgtgctgatgagaagggtcattaccccagcaagtgcatcgtggagcagatc
ttggtcttaggccttaagaagaagccatcttctgtgactacccattcttctgatggtaaa
gttcagcctgcaacttttgcgtactgtgccaaaacatgtaccctgagtctgaagaagctg
tctctgagtgttggtgatgactgggaggtccatgtcagctga

DBGET integrated database retrieval system