KEGG   Rattus norvegicus (rat): 24385Help
Entry
24385             CDS       T01003                                 

Gene name
Gck, GLK, GLUKA, RNGK2
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04917  Prolactin signaling pathway
rno04922  Glucagon signaling pathway
rno04930  Type II diabetes mellitus
rno04950  Maturity onset diabetes of the young
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24385 (Gck)
   00052 Galactose metabolism
    24385 (Gck)
   00500 Starch and sucrose metabolism
    24385 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    24385 (Gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    24385 (Gck)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24385 (Gck)
   04910 Insulin signaling pathway
    24385 (Gck)
   04922 Glucagon signaling pathway
    24385 (Gck)
   04917 Prolactin signaling pathway
    24385 (Gck)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    24385 (Gck)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    24385 (Gck)
   04950 Maturity onset diabetes of the young
    24385 (Gck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     24385 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF4795
Motif
Other DBs
NCBI-GeneID: 24385
NCBI-ProteinID: NP_036697
RGD: 2670
Ensembl: ENSRNOG00000061527
UniProt: P17712 Q64596
LinkDB All DBs
Position
14q21
AA seq 465 aa AA seqDB search
MAMDTTRCGAQLLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDLDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSANPGQQLYEKIIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLRPS
VTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLAQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctatggatactacaaggtgtggagcccagttgttgactctggtcgagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaggctggagacccacgaggaggccagtgtaaagatgttacccacc
tacgtgcgttccaccccagaaggctcagaagtcggagactttctctccttagacctggga
ggaaccaacttcagagtgatgctggtcaaagtgggagagggggaggcagggcagtggagc
gtgaagacaaaacaccagatgtactccatccccgaggacgccatgacgggcactgccgag
atgctctttgactacatctctgaatgcatctctgacttccttgacaagcatcagatgaag
cacaagaaactgcccctgggcttcaccttctccttccctgtgaggcacgaagacctagac
aagggcatcctcctcaattggaccaagggcttcaaggcctctggagcagaagggaacaac
atcgtaggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaacgacacagtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcactggctgcaatgcctgctacatggaggaaatgcagaat
gtggagctggtggaaggggatgagggacgcatgtgcgtcaacacggagtggggcgccttc
ggggactcgggcgagctggatgagttcctactggagtatgaccggatggtggatgaaagc
tcagcgaaccccggtcagcagctgtacgagaagatcatcggtgggaagtatatgggcgag
ctggtacgacttgtgctgcttaagctggtggacgagaaccttctgttccacggagaggcc
tcggagcagctgcgcacgcgtggtgcttttgagacccgtttcgtgtcacaagtggagagc
gactccggggaccgaaagcagatccacaacatcctaagcactctggggcttcgaccctct
gtcaccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccat
atgtgctccgcaggactagctggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcatcgaa
tcagaggagggcagcggcaggggagccgcgctggtctctgcggtggcctgcaagaaggct
tgcatgctggcccagtga

DBGET integrated database retrieval system