KEGG   Rattus norvegicus (rat): 24413
Entry
24413             CDS       T01003                                 

Gene name
Nr3c1, GR, Gcr, Grl
Definition
(RefSeq) nuclear receptor subfamily 3, group C, member 1
  KO
K05771  glucocorticoid receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24413 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24413 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24413 (Nr3c1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    24413 (Nr3c1)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   24413 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 TFIIA Rpp20
Other DBs
NCBI-GeneID: 24413
NCBI-ProteinID: NP_036708
RGD: 2741
UniProt: P06536
LinkDB
Structure
PDB: 

Position
18p11
AA seq 794 aa
MDSKESLAPPGRDEVPGSLLGQGRGSVMDFYKSLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSTSNVQQRQQQQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMGN
DLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSVPENPKSSTSATGCATPTEKEFPKTH
SDASSEQQNRKSQTGTNGGSVKLYPTDQSTFDLLKDLEFSAGSPGKDTNESPWRSDLLID
ENLLSPLAGEDDPFLLEGDTNEDCKPLILPDTKPKIKDTGDTILSSPSSVALPQVKTEKD
DFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASL
SQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDSLTSLGALNFPGRSVFSNGYSSPGMRPD
VSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRND
CIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPA
ALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPG
FRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQC
KHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVK
REGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPK
YSNGNIKKLLFHQK
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggactccaaagaatccttagctccccctggtagagacgaagtccctggcagtttgctt
ggccaggggagggggagcgtaatggacttttataaaagcctgaggggaggagctacagtc
aaggtttctgcatcttcgccctcagtggctgctgcttctcaggcagattccaagcagcag
aggattctccttgatttctcgaaaggctccacaagcaatgtgcagcagcgacagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagccagacttatccaaa
gccgtttcactgtccatggggctgtatatgggagagacagaaacaaaagtgatggggaat
gacttgggctacccacagcagggccaacttggcctttcctctggggaaacagactttcgg
cttctggaagaaagcattgcaaacctcaataggtcgaccagcgttccagagaaccccaag
agttcaacgtctgcaactgggtgtgctaccccgacagagaaggagtttcccaaaactcac
tcggatgcatcttcagaacagcaaaatcgaaaaagccagaccggcaccaacggaggcagt
gtgaaattgtatcccacagaccaaagcacctttgacctcttgaaggatttggagttttcc
gctgggtccccaggtaaagacacaaacgagagtccctggagatcagacctgttgatagat
gaaaacttgctttctcctttggcgggagaagatgatccattccttctcgaaggggacacg
aatgaggattgtaagcctcttattttaccggacactaaacctaaaattaaggatactgga
gatacaatcttatcaagtcccagcagtgtggcactgccccaagtgaaaacagaaaaagat
gatttcattgaactttgcacccccggggtaattaagcaagagaaactgggcccagtttat
tgtcaggcaagcttttctgggacaaatataattggtaataaaatgtctgccatttctgtt
catggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatccctt
tctcagcagcaggatcagaagcctgtttttaatgtcattccaccaattcctgttggttct
gaaaactggaataggtgccaaggctccggagaggacagcctgacttccttgggggctctg
aacttcccaggccggtcagtgttttctaatgggtactcaagccctggaatgagaccagat
gtaagctctcctccatccagctcgtcagcagccacgggaccacctcccaagctctgcctg
gtgtgctccgatgaagcttcaggatgtcattacggggtgctgacatgtggaagctgcaaa
gtattctttaaaagagcagtggaaggacagcacaattacctttgtgctggaagaaacgat
tgcatcattgataaaattcgaaggaaaaactgcccagcatgccgctatcggaaatgtctt
caggctggaatgaaccttgaagctcgaaaaacaaagaaaaaaatcaaagggattcagcaa
gccactgcaggagtctcacaagacacttcggaaaatcctaacaaaacaatagttcctgca
gcattaccacagctcacccctaccttggtgtcactgctggaggtgattgaacccgaggtg
ttgtatgcaggatatgatagctctgttccagattcagcatggagaattatgaccacactc
aacatgttaggtgggcgtcaagtgattgcagcagtgaaatgggcaaaggcgataccaggc
ttcagaaacttacacctggatgaccaaatgaccctgctacagtactcatggatgtttctc
atggcatttgccctgggttggagatcatacagacaatcaagtggaaacctgctctgcttt
gctcctgatctgattattaatgagcagagaatgtctctaccctgcatgtatgaccaatgt
aaacacatgctgtttgtctcctctgaattacaaagattgcaggtatcctatgaagagtat
ctctgtatgaaaaccttactgcttctctcctcagttcctaaggaaggtctgaagagccaa
gagttatttgatgagattcgaatgacttatatcaaagagctaggaaaagccatcgtcaaa
agggaagggaactccagtcagaactggcaacggttttaccaactgacaaagcttctggac
tccatgcatgaggtggttgagaatctccttacctactgcttccagacatttttggataag
accatgagtattgaattcccagagatgttagctgaaatcatcactaatcagataccaaaa
tattcaaatggaaatatcaaaaagcttctgtttcatcaaaaatga

DBGET integrated database retrieval system