KEGG   Rattus norvegicus (rat): 24495
Entry
24495             CDS       T01003                                 

Gene name
Il3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04664  Fc epsilon RI signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24495 (Il3)
   04151 PI3K-Akt signaling pathway
    24495 (Il3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24495 (Il3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    24495 (Il3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24495 (Il3)
   04664 Fc epsilon RI signaling pathway
    24495 (Il3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24495 (Il3)
   05202 Transcriptional misregulation in cancer
    24495 (Il3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24495 (Il3)
  09163 Immune disease
   05310 Asthma
    24495 (Il3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24495 (Il3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24495 (Il3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24495 (Il3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Cytokines
   24495 (Il3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 24495
NCBI-ProteinID: NP_113701
RGD: 2897
Ensembl: ENSRNOG00000026786
UniProt: P97688
LinkDB
Position
10q22
AA seq 169 aa
MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVS
GLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLP
GVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
NT seq 510 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccaccagcatcctctgtatgctgctcccgctcctgatgctc
ttccaccagggactccagatttcagacaggggctcagatgcccaccatttactcaggacg
ttggattgcaggactattgccttggagattttggtgaagctcccatatcctcaggtatct
ggactcaataatagtgacgacaaagccaatctgaggaatagtaccttgcggagagtaaac
ctggacgaattcctaaaaagccaagaggagtttgattctcaggacacaacggacatcaag
tccaaacttcagaaacttaagtgttgtattcctgcagctgcgagcgactctgtgttgcca
ggtgtctacaataaagatctggatgactttaagaagaaactgagattctacgtgatccat
cttaaggacctgcagccagtgtcagtctctagaccacctcagcccacatctagctctgac
aactttcgccctatgaccgtggaatgttaa

DBGET integrated database retrieval system