KEGG   Rattus norvegicus (rat): 24599
Entry
24599             CDS       T01003                                 

Gene name
Nos2, Nos2a, iNos
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04146  Peroxisome
rno04371  Apelin signaling pathway
rno04926  Relaxin signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    24599 (Nos2)
   00330 Arginine and proline metabolism
    24599 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24599 (Nos2)
   04066 HIF-1 signaling pathway
    24599 (Nos2)
   04020 Calcium signaling pathway
    24599 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24599 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    24599 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24599 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    24599 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24599 (Nos2)
   05014 Amyotrophic lateral sclerosis
    24599 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24599 (Nos2)
   05152 Tuberculosis
    24599 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24599 (Nos2)
   05145 Toxoplasmosis
    24599 (Nos2)
   05140 Leishmaniasis
    24599 (Nos2)
   05142 Chagas disease
    24599 (Nos2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24599 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 24599
NCBI-ProteinID: NP_036743
RGD: 3185
Ensembl: ENSRNOG00000057443
UniProt: Q06518
LinkDB
Position
10q25
AA seq 1147 aa
MACPWKFLFRVKSYQGDLKEEKDINNNVEKTPGAIPSPTTQDDPKSHKHQNGFPQFLTGT
AQNVPESLDKLHVTPSTRPQHVRIKNWGNGEIFHDTLHHKATSDISCKSKLCMGSIMNSK
SLTRGPRDKPTPVEELLPQAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTL
DELIFATKMAWRNAPRCIGRIQWSNLQVFDARSCSTASEMFQHICRHILYATNSGNIRSA
ITVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPATLEFTQLCIDLGWKPRYGRFD
VLPLVLQAHGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLE
FPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRSMGLETHTLASLWKDRAVTEINAAVL
HSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNY
VLSPFYYYQIEPWKTHIWQDEKLRPRRREIRFTVLVKAVFFASVLMRKVMASRVRATVLF
ATETGKSEALARDLAALFSYAFNTKVVCMEQYKANTLEEEQLLLVVTSTFGNGDCPSNGQ
TLKKSLFMMKELGHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELS
GQEDAFRSWAVQTFRAACETFDVRSKHCIQIPKRYTSNATWEPEQYKLTQSPESLDLNKA
LSSIHAKNVFTMRLKSLQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTAL
VQGILERVVDCSSPDQTVCLEVLDESGSYWVKDKRLPPCSLRQALTYFLDITTPPTQLQL
HKLARFATEETHRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLRVPAAFLLLQLPIL
KPRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWINNLKPEDPVPCFVRS
VSGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHRGLKGGRMTLVFGCRHPEEDH
LYQEEMQEMVRKGVLFQVHTGYSRLPGKPKVYVQDILQKELADEVFSVLHGEQGHLYVCG
DVRMARDVATTLKKLVAAKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGNTLE
EPKGTRL
NT seq 3444 nt   +upstreamnt  +downstreamnt
atggcttgcccctggaagtttctcttcagagtcaaatcctaccaaggtgacctgaaagag
gaaaaggacattaacaacaacgtggagaaaaccccaggtgctattcccagcccaacaaca
caggatgaccctaagagtcacaagcatcaaaatggtttcccccagttcctcactgggact
gcacagaatgttccagaatccctggacaagctgcatgtgactccatcgacccgcccacag
cacgtgaggatcaaaaactggggcaatggagagatttttcacgacacccttcaccacaag
gccacctcggatatctcttgcaagtccaaattatgcatggggtccatcatgaactccaag
agtttgaccagaggacccagagacaagcccaccccagtggaggagcttctgcctcaagcc
attgaattcattaaccagtattatggctccttcaaagaggcaaaaatagaggaacatctg
gccaggctggaagccgtaacaaaggaaatagaaacaacaggaacctaccagctcactctg
gatgagctcatctttgccaccaagatggcctggaggaacgcccctcgctgcatcggcagg
attcagtggtccaacctgcaggtcttcgatgcccggagctgtagcactgcatcagaaatg
ttccagcatatctgcagacacatactttacgccactaacagtggcaacatcaggtcggcc
attactgtgttcccccagcggagcgatgggaagcatgacttccggatctggaattcccag
ctcatccggtacgctggctaccagatgcccgatggcaccatcagaggggatcctgccacc
ttggagttcacccagttgtgcatcgacctgggctggaagccccgctatggccgcttcgat
gtgctgcctctggtcctgcaggctcacggtcaagatccagaggtctttgaaatccctcct
gatcttgtgctggaggtgaccatggagcatcccaagtacgagtggttccaggagctcggg
ctgaagtggtatgcgctgcctgccgtggccaacatgctcctggaggtgggtggcctcgag
ttcccagcctgccccttcaatggttggtacatgggcaccgagattggagtccgagacttc
tgtgacacacagcgctacaacatcctggaggaagtgggcaggagcatgggcctggagacc
cacacactggcctccctctggaaagaccgggctgtcaccgagatcaatgcagctgtgctc
catagttttcagaagcagaatgtgaccatcatggaccaccacacagcctcagagtccttc
atgaagcacatgcagaatgagtaccgggcccgaggaggctgccctgcagactggatttgg
ctggtccctccggtgtccgggagcatcacccctgtgttccaccaggagatgttgaactac
gtcctatctccattctactactaccagatcgagccctggaagacccacatctggcaggat
gagaagctgaggcccaggaggagagagatccggttcacagtcttggtgaaagcggtgttc
tttgcttctgtgctaatgcggaaggtcatggcttcccgcgtcagagccacagtcctcttt
gctactgagacaggaaagtcggaagcgctagccagggacctggctgccttgttcagctac
gccttcaacaccaaggttgtctgcatggaacagtataaggcaaacaccttggaagaggaa
caactactgctggtggttacaagcacatttggcaatggagactgccccagcaatgggcag
actctgaagaaatctctgttcatgatgaaagaactcgggcataccttcaggtatgcggta
tttggcctgggctccagcatgtaccctcagttctgtgcctttgctcatgacatcgaccag
aaactgtctcacctgggagcctcccagcttgccccaaccggagaaggggacgaactcagc
gggcaggaggacgccttccgcagctgggctgtgcaaaccttccgggcagcctgtgagacg
ttcgatgttcgaagcaaacattgcattcagatcccgaaacgctacacttccaacgcaaca
tgggagccagagcagtacaagctcacccagagcccagagtctctagacctcaacaaagct
ctcagcagcatccacgccaagaacgtgttcaccatgaggctgaaatccctccagaatctg
cagagtgagaagtccagccgcaccaccctccttgttcaactcaccttcgagggcagccga
ggccccagctacctacctggggaacacctggggattttcccaggcaaccagacggccctg
gtgcaagggatcttggagcgagttgtggattgttcttcgccagaccaaactgtgtgcctg
gaggttctagatgagagtggcagctactgggtcaaagacaagaggcttcccccctgctca
ctcaggcaagccctcacctacttcctggacatcactacccctcccacccagctgcagctc
cacaagctggcccgctttgccacggaagagacgcacaggcagaggttggaggccttgtgt
cagccctcagagtacaacgattggaagttcagcaacaaccccacgttcctggaggtgctg
gaagagttcccatcattgcgtgtgcctgctgccttcctgctgttgcagctccccattctg
aagccccgctactactccatcagctcctcccaggaccacaccccctcggaggtccacctc
actgtggctgtggtcacctatcgcacccgagatggtcagggtcccctgcaccatggcgtc
tgcagcacttggatcaataacctgaagcccgaagacccagtgccctgctttgtgcggagt
gtcagtggcttccagctccctgaggacccctcccagccctgcatcctcattgggcccggt
acaggcattgcccccttccgaagtttctggcagcagcggctccatgactctcagcacaga
gggctcaaaggaggccgcatgaccttggtgtttgggtgcaggcacccagaggaggaccac
ctctatcaggaagaaatgcaggagatggtccgcaagggagtgttgttccaggtgcacaca
ggctactcccggctgcccggaaaacccaaggtctacgttcaagacatcctgcagaaagag
ctggccgacgaggtgttcagcgtgctccacggggagcagggccacctttatgtttgtggc
gatgtgcgcatggctcgggatgtggctaccactttgaagaagctggtggccgccaagctg
aacttgagtgaggagcaggttgaggattacttcttccagctcaagagccagaaacgttat
catgaggatatcttcggtgcggtcttttcctatggagcaaaaaagggcaacaccttggag
gagcccaaaggcacaagactctga

DBGET integrated database retrieval system