KEGG   Rattus norvegicus (rat): 246144
Entry
246144            CDS       T01003                                 

Gene name
Il3ra, Cyrl
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    246144 (Il3ra)
   04151 PI3K-Akt signaling pathway
    246144 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246144 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    246144 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    246144 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    246144 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    246144 (Il3ra)
   04090 CD molecules [BR:rno04090]
    246144 (Il3ra)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL3 receptor family
   246144 (Il3ra)
CD molecules [BR:rno04090]
 Proteins
  246144 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 246144
NCBI-ProteinID: NP_640353
RGD: 628728
Ensembl: ENSRNOG00000001325
UniProt: E9PSX4
LinkDB
Position
12q11
AA seq 386 aa
MAAGVWLLLSVTMFEAMSERGVHMEAPPLTPPIRNLSIDPAQRRLTWEWGGGGTRAEGGA
LGPRFLCRKEGRDPVRADPAGHSCSFPALSHCHVTNFTVFPEGQEKDAAHLCFQPRDPNR
AAAARNLHCWVHDVDWLSCRWGRGPGATRDVRYRMFLRDARHSPDHDRECPRYEVDSQGS
RVGCAVGEAGTLASLITVTVNGSGGAHGVHAPVSCTDADIDMAAVEVLAPPVLTAECEST
GARVRWAPQSRFQTAFVFTLQINQSSQTEPKLEMVYETEFKVPTLDTVSVRVKATALDSG
VESDWSKAWSLDCGPTATLATPMTSLLLAGAGAVLTVMAVLLLCWRKSLLSRLFPPIPRM
RVLPGPEMVAWVEAPENCEVTLVTDN
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctgccggagtgtggctgctgctgtcggttactatgttcgaggcgatgtcagaacgg
ggagtccatatggaggccccacctctgacaccgcccatcaggaacctaagcatcgacccc
gcccagcgcaggctgacgtgggagtggggcgggggcgggaccagggcagagggcggggcc
ttgggtcccaggttcctgtgcagaaaggaggggcgggaccctgtgcgggcggaccctgca
ggtcattcctgctccttccctgccctttcccactgtcacgtaaccaacttcactgtcttc
cccgaggggcaagagaaggatgcggcccacctgtgcttccagccccgtgaccccaacagg
gcggctgccgcccgcaacctgcactgctgggtgcacgacgtggattggctgagttgccgc
tggggtcggggccctggggcaacacgggatgtgcgatacagaatgttcctgcgagatgca
aggcacagcccagaccacgaccgtgagtgcccgaggtacgaggttgactcccaagggtcg
cgcgtgggctgtgcggtgggtgaggctgggaccctggcctccctcatcacagtgacggtg
aacggcagtggtggcgcccatggggtccacgcgcccgtgtcttgtaccgacgcggatatc
gacatggctgccgtggaggtcctggccccgcccgtgctgacagctgaatgcgaaagcacc
ggggcccgtgtgaggtgggcgccgcagagccggttccagacggccttcgtgttcactctg
cagatcaaccagagttcacagacagagccaaagcttgagatggtatatgagacagaattc
aaggtcccgaccctggacacggtttctgtgcgtgtcaaggccacagccctggactcgggc
gtggagagcgactggagcaaggcctggagcctggactgtggccccacagcgactctggca
accccgatgacatcgctgctcctggcgggggcgggcgcggtgctcacagtgatggctgtg
ctgctgctgtgctggaggaagtcgctgctgagccgcctgttcccacccatcccaaggatg
agagtcctacctgggccagagatggttgcatgggtcgaggcacctgagaactgcgaggtg
acgctggtgacagacaactga

DBGET integrated database retrieval system