KEGG   Rattus norvegicus (rat): 24644
Entry
24644             CDS       T01003                                 

Gene name
Pgk1
Definition
(RefSeq) phosphoglycerate kinase 1
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24644 (Pgk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24644 (Pgk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24644 (Pgk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     24644 (Pgk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24644 (Pgk1)
SSDB
Motif
Pfam: PGK DUF3172
Other DBs
NCBI-GeneID: 24644
NCBI-ProteinID: NP_445743
RGD: 619878
Ensembl: ENSRNOG00000058249
Vega: OTTRNOG00000001775
UniProt: P16617
LinkDB
Position
X
AA seq 417 aa
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGSEVENACANPAAGTVILLE
NLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGTESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKSLMDEVV
KATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNV
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcgctttctaacaagctgactttggacaagctggacgtgaaggggaagcgggtcgtg
atgagggtggacttcaatgttcctatgaagaacaaccagataacgaataaccaaaggatc
aaggctgctgtcccaagcatcaaattctgcttggacaatggagccaagtcggttgtgctt
atgagccacctgggccgtcctgatggtgtgcccatgcccgacaagtactccttagagcca
gttgctgcagaactcaaatctctgctgggcaaggatgttctgttcttgaaggattgtgtg
ggctcagaagtagagaatgcctgtgccaacccagcggctgggactgtcatcctcctggag
aacctccgctttcatgtagaggaagaagggaagggaaaagatgcttctgggaacaaggtt
aaagctgagccagctaaaattgatgctttccgagcctccctgtccaaacttggagatgtc
tatgtcaatgatgcttttgggactgcacacagagcccacagttccatggtgggtgtgaat
ctgccacagaaggctggtggatttttgatgaagaaggagctgaactactttgccaaggct
ttggagagtccagagcgacccttcctggctatcttgggaggagctaaagttgcagacaag
atccagctgatcaataatatgctagacaaagtcaatgagatgatcatcggtgggggaatg
gcttttaccttccttaaggtgctcaacaacatggagattggcacatctctgtatgatgaa
gagggagccaagattgtcaaagatctcatggccaaagctgagaaaaatggtgtgaagatt
accttgcctgttgactttgtcactgctgacaaatttgatgagaatgcaaagactggccaa
gctactgtggcctctggtatacctgctggctggatgggcttggactgtggtactgagagc
agtaagaaatatgctgaggctgtggctcgagctaagcagattgtttggaacggtcctgtt
ggggtatttgaatgggaagcctttgccaggggaaccaagtccctcatggatgaggtggtg
aaagccacgtctaggggctgcatcactatcataggaggcggagacaccgccacttgctgt
gccaaatggaacacagaggataaagtcagccatgtgagcactgggggcggcgccagtcta
gagctcctggaaggtaaagtccttcctggggtggatgctctcagcaatgtttag

KEGG   Rattus norvegicus (rat): 316265
Entry
316265            CDS       T01003                                 

Gene name
Pgk2
Definition
(RefSeq) phosphoglycerate kinase 2
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    316265 (Pgk2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    316265 (Pgk2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    316265 (Pgk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     316265 (Pgk2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   316265 (Pgk2)
SSDB
Motif
Pfam: PGK Mt_ATP_synt
Other DBs
NCBI-GeneID: 316265
NCBI-ProteinID: NP_001012130
RGD: 1306627
Ensembl: ENSRNOG00000013600
UniProt: Q5XIV1
LinkDB
Position
9
AA seq 417 aa
MALSSKLTLDKVDVKEKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKYCLDNGATSVVL
MSHLGRPDGIPMPDKYSLQPVAAELKSLLNKDVIFLKDCVGSEIEKACANPGKGSVILLE
NLRFHVEEEGKGKDASGQKITAEPDKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGIN
LPQKASGFLMKKELDYFSKVLEKPERPFLAILGGAKVTDKIQLIKNMLDKVNFMIIGGAM
AFTFLKELKNMKIGASLFDEDGAKIVKEIMDKAEKNGVKITFPVDFVTGDKFDEHAKVGQ
ATVESGIPSGWMGLDCGPESIKNNAQIVAQAKLIVWNGPLGVFEWDGFAKGTKALMDEVV
KATSNGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKTLPGVEALSNM
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctctttctagtaagttgactctggacaaagtggatgttaaggaaaaaagagtcatc
atgagagtagatttcaacgttcccatgaagaataaccaaattacaaacaaccagagaatc
aaggctgccatcccaagcatcaaatactgtctggacaatggagccacgtccgtagttctc
atgagtcacctcggccggcctgatggtatccccatgccggacaaatactcattacagcct
gttgctgctgagctcaagtccctactgaacaaggacgttatattcttaaaggactgtgtg
ggctctgaaatagagaaagcctgtgccaacccaggtaaaggctctgtaatccttctggag
aacctgcgctttcatgtggaggaagaagggaagggtaaagatgcttctggacaaaagatt
accgctgagcctgataaagtggaagccttccgagcttcactgtccaaactcggtgatgtc
tacgtcaacgatgcttttggcactgcacatcgggctcacagttccatggtgggaataaat
ttgccccagaaggcatctgggttcctcatgaagaaggagctagattatttttccaaggtc
ttagaaaagccagagaggcccttcctggctattcttggtggagccaaagtgacagacaag
atccaacttatcaaaaatatgttagacaaagtcaatttcatgattattggtggtgcgatg
gctttcaccttcctgaaagaactcaagaacatgaagattggtgcttccttgtttgatgaa
gacggagccaagatcgtcaaagagatcatggacaaggcagaaaagaatggcgtaaagata
acctttcctgttgactttgttaccggtgacaagtttgatgagcatgctaaagttggacaa
gccactgtagaatctggtataccatctggctggatgggtttggattgcggccctgagagc
attaaaaacaatgctcaaattgtggcccaagcaaagctgattgtttggaatggacctctg
ggggtatttgaatgggatggctttgctaagggaaccaaagccctcatggatgaagttgta
aaggccacctccaatggctgtatcaccatcataggaggcggggacactgctacttgctgt
gccaaatggaacactgaagacaaggtcagccatgtgagcacaggaggcggggcaagtctt
gagcttctggaaggcaaaacccttccaggggtagaggccctcagcaacatgtaa

DBGET integrated database retrieval system