KEGG   Rattus norvegicus (rat): 24708
Entry
24708             CDS       T01003                                 

Gene name
Rb1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    24708 (Rb1)
   04218 Cellular senescence
    24708 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24708 (Rb1)
   05203 Viral carcinogenesis
    24708 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    24708 (Rb1)
   05225 Hepatocellular carcinoma
    24708 (Rb1)
   05226 Gastric cancer
    24708 (Rb1)
   05214 Glioma
    24708 (Rb1)
   05220 Chronic myeloid leukemia
    24708 (Rb1)
   05218 Melanoma
    24708 (Rb1)
   05219 Bladder cancer
    24708 (Rb1)
   05215 Prostate cancer
    24708 (Rb1)
   05224 Breast cancer
    24708 (Rb1)
   05222 Small cell lung cancer
    24708 (Rb1)
   05223 Non-small cell lung cancer
    24708 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24708 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24708 (Rb1)
   05161 Hepatitis B
    24708 (Rb1)
   05160 Hepatitis C
    24708 (Rb1)
   05163 Human cytomegalovirus infection
    24708 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24708 (Rb1)
   05169 Epstein-Barr virus infection
    24708 (Rb1)
   05165 Human papillomavirus infection
    24708 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24708 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24708 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24708 (Rb1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24708 (Rb1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    24708 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 24708
NCBI-ProteinID: NP_058741
RGD: 3540
Ensembl: ENSRNOG00000016029
UniProt: P33568
LinkDB
Position
15q11
AA seq 920 aa
MPPKAPRRTAAAEPPPPPPPPPEDDPAQDSDPEELPLIRLEFEKIEEPEFIALCQKLKVP
DHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETS
VYKFFDLLKEIDTSTKVDNAVSRLLKKYNVLCALYSKLERTCGLIYLTQPSSGLSTEINS
MLVLKVSWITFLLAKGEVVQMEDDLVISFQLMLCVLDYFIKLSPPALLREPYKTAATPIN
GSPRTPRRGQNRSARIAKQLESDTRTIEVLCKEHECNVDEVKNVYFKNFIPFISSLGIVS
SNGLPELESLSKRYEEVYLKSKDLDARLFLDHDKTLQTDTIDSFETERTPRKSNPDEEAN
MVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFSNCTVNPKENILKRVKDVGHIFK
EKFASAVGQGCIDIGAQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLL
ACALEVVMATYSRSMLQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMI
KHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDHLESACSLSLPLQSNHTAADMYLS
PIRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLSLFYKKVYRLAYLRLNTLCAR
LLSDHPEPEHIIWTLFQHTLENEYELMKDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAY
KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRS
PYKFSSSPLRIPGGNIYMSPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKI
NQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTR
TRMQKQKLNDSMEISNKEEK
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagaaccgcggccgccgagcccccgccgccgccgccgccg
cctccggaggacgaccccgcgcaggacagtgaccccgaagagctgcccctgatcaggctt
gagtttgaaaaaattgaagaacctgaatttattgcattatgtcagaagttaaaggtgccc
gatcatgtcagagagagagcttggctaacgtgggagaaagtttcatctgtggatggaatc
ctggaaggatatattcagaagaagaaggaactctggggcatctgcatcttcattgcagca
gttgacctggatgagatgccattcacttttactgagcttcagaaaagcatagaaaccagt
gtctataaattctttgacttattaaaagaaattgataccagtaccaaagttgataatgct
gtgtcaaggctattgaagaagtacaatgtgttatgtgcactctacagcaaattagaacgg
acatgtggacttatatatttgacacagcccagcagtgggttatctactgaaataaattct
atgttggtgctaaaagtttcttggatcacctttttactagctaaaggagaagtagtacag
atggaagatgatctggtgatctcatttcagttaatgttgtgtgtacttgactattttatc
aagctctcgcctcctgcgctgctcagagagccgtacaaaacagctgcaacacccattaat
ggttcacctcggacacccagaagaggtcagaacaggagtgctcggatagcaaaacaacta
gaaagtgatacaagaactattgaagttctctgtaaggagcacgagtgtaatgtagatgag
gtgaaaaatgtttatttcaaaaattttatcccttttataagttcacttggaattgtatca
tctaatggacttccagagcttgaaagtctttctaaacgctacgaagaagtttatcttaaa
agcaaagatttagatgcaagactatttttggatcatgacaaaacacttcagactgatact
atagacagttttgaaacagagagaactccacgaaaaagcaaccctgatgaagaggcaaac
atggttactccacacactccagttaggactgttatgaatactattcaacagttaatggtg
attttaaattctgcaagtgatcagccatcagaaaatctgatttcctacttcagtaattgc
acagtgaatccaaaagaaaatatcctaaaaagagtaaaggatgttggacacatctttaaa
gagaagtttgctagcgctgtggggcagggatgtattgacattggagcacagcgatataaa
cttggggttcgattgtattatcgtgtgatggaatcgatgcttaaatcagaagaagaacgt
ttgtccattcagaattttagcaaactcctaaatgacaacatctttcatatgtctttattg
gcctgtgctcttgaagttgtaatggctacatatagcaggagtatgttacagaatcttgat
tctggaacagatttgtccttcccgtggattctgaatgtacttaatttaaaagcctttgat
ttttacaaagtgattgaaagttttatcaaagtggaagccaacttgacaagagaaatgata
aaacatttagaaagatgtgagcatcgaatcatggaatcccttgcatggctttctgattca
cctttgtttgatctcataaagcagtccaaggatggggaaggacctgatcaccttgagtct
gcttgttctctcagcctccctctccagagtaaccacactgcagcagatatgtatctttct
cctataagatctccaaagaaaagaacttctactacacgtgtaaattctgcggcaaataca
gagacgcaagcagcctcagccttccatactcagaagccattgaaatctacctccctttcc
ctgttttacaaaaaagtgtaccgtctagcatatctccgactaaatacactgtgtgcgcgc
cttctgtctgaccacccagagccagaacacatcatctggactctgtttcagcatacattg
gaaaatgagtatgagctcatgaaagaccgacatttggaccagattatgatgtgttctatg
tatggcatctgcaaggtgaaaaacattgaccttaaattcaaaatcatcgtaactgcgtat
aaggatcttcctcacgctgcccaggagacctttaaacgtgttttgatcagagaagaggag
tttgattccattatagtgttctacaactcagttttcatgcagagactaaaaacaaatatt
ttacagtatgcctccaccaggcctcctaccttgtcaccaatacctcacattcctcgaagc
ccttacaagttctcgagttcacccttgcggattcctggaggtaacatctatatgtcaccc
ctaaagagtccttataaaatttcagaaggtctgccaacacccacaaaaatgactccaaga
tcaagaatcttggtctcaatcggtgaatcatttgggacatccgagaagttccagaaaata
aaccagatggtgtgtaacagtgacagagtgctcaaaagaagtgctgaaggcggcaatccc
cccaaacccctgaagaagctgcgctttgacatcgaaggatccgatgaagcagacgggagt
aaacatctcccagcggagtccaaattccaacagaaactggcagaaatgacttctactcga
acacgaatgcaaaagcagaaactgaatgatagcatggaaatctcaaacaaggaggaaaag
tga

DBGET integrated database retrieval system