KEGG   Rattus norvegicus (rat): 24787Help
Entry
24787             CDS       T01003                                 

Gene name
Sod2, MnSOD
Definition
(RefSeq) superoxide dismutase 2, mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04146  Peroxisome
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    24787 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24787 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    24787 (Sod2)
   04213 Longevity regulating pathway - multiple species
    24787 (Sod2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    24787 (Sod2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     24787 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 24787
NCBI-ProteinID: NP_058747
RGD: 3732
Ensembl: ENSRNOG00000019048
UniProt: P07895
LinkDB All DBs
Position
1q11
AA seq 222 aa AA seqDB search
MLCRAACSAGRRLGPAASTAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVN
NLNVTEEKYHEALAKGDVTTQVALQPALKFNGGGHINHSIFWTNLSPKGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSQRYIVCKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggcggcgtgcagcgcgggcagaagactgggccccgcggccagtaccgcg
ggctcccggcacaagcacagcctccctgacctgccttacgactatggcgcgctggagccg
cacattaacgcgcagatcatgcagctgcaccacagcaagcaccacgcgacctacgtgaac
aatctgaacgtcaccgaggagaagtaccacgaggcgctggccaagggagatgttacaact
caggttgctcttcagcctgcactgaagttcaatggcgggggccatatcaatcacagcatt
ttctggacaaacctgagccctaagggtggtggagaacccaaaggagagttgctggaggct
atcaagcgtgactttgggtcttttgagaagtttaaggagaaactgacagctgtgtctgtg
ggagtccaaggttcaggctggggctggcttggcttcaataaggagcaaggtcgcttacag
attgccgcctgctctaatcaggacccactgcaaggaaccacaggccttattccactgctg
gggattgatgtgtgggagcacgcttactatcttcagtataaaaacgtcagacctgactat
ctgaaagccatttggaatgtaatcaactgggagaatgttagccaaagatacatagtttgc
aagaagtga

DBGET integrated database retrieval system