KEGG   Rattus norvegicus (rat): 24788Help
Entry
24788             CDS       T01003                                 

Gene name
Sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
Module
rno_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24788 (Sord)
   00051 Fructose and mannose metabolism
    24788 (Sord)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     24788 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP TrkA_N Pyr_redox_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 24788
NCBI-ProteinID: NP_058748
RGD: 3734
Ensembl: ENSRNOG00000017291
UniProt: P27867
LinkDB All DBs
Position
3q35
AA seq 357 aa AA seqDB search
MAAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDF
VVKKPMVLGHEAAGTVTKVGPMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFC
ATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCG
AGPIGIVTLLVAKAMGASQVVVIDLSASRLAKAKEVGADFTIQVAKETPHDIAKKVESVL
GSKPEVTIECTGAESSVQTGIYATHSGGTLVVVGMGPEMINLPLVHAAVREVDIKGVFRY
CNTWPMAVSMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGLGLKVMIKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcctgctaagggcgagaacctgtccctggtggtgcacggacctggagacatt
cgcctggagaactacccaatccctgagctgggcccaaatgatgtgttactaaagatgcat
tcggtggggatctgtggctcggatgttcactactgggagcatggccgaattggggacttc
gttgtgaaaaagccaatggtgcttgggcatgaagctgctggaacagtcacaaaagtggga
ccgatggtgaaacatctaaaaccaggagatcgggtggccatcgagcctggcgttccccga
gaaatagatgaattctgcaagatcggccgatacaatctgacgccatccatcttcttctgt
gccacgcccccagatgatgggaacctctgccgcttctacaagcacagcgctgacttctgc
tacaagcttcctgatagtgtcacctttgaagaaggggccctgattgagcctctctctgtg
gggatctatgcctgccgtcgaggttcggtttccctggggaacaaggtccttgtgtgtgga
gctgggccaattgggatagtcactttgcttgtggccaaagcaatgggagcttctcaagta
gtggtgattgacctctctgcttctcggttagccaaggccaaggaagttggagcagacttt
accatccaggttgccaaagagacccctcacgacattgccaagaaggtggaaagtgtgctg
gggagcaagccagaggtcaccatcgaatgcacgggagcggagtcctctgtccagacgggc
atctatgccactcactctggcgggaccttggtggttgtgggaatgggccccgagatgatc
aatttacccctagtgcacgcagctgtgcgggaggtggacatcaaaggcgtgtttcgatac
tgcaacacgtggccgatggcagtttccatgcttgcatcgaagactttgaatgtaaagccc
ttagtgacccataggttccccctggagaaggctgtagaagcctttgaaacagccaaaaag
ggactggggctgaaagttatgatcaagtgtgaccccaatgaccagaacccctaa

DBGET integrated database retrieval system