KEGG   Rattus norvegicus (rat): 24834Help
Entry
24834             CDS       T01003                                 

Gene name
Tk1, Tk
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    24834 (Tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    24834 (Tk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     24834 (Tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 24834
NCBI-ProteinID: NP_434687
RGD: 621014
Ensembl: ENSRNOG00000047314
UniProt: P27158 M0RCX2
LinkDB All DBs
Position
10q32.2
AA seq 232 aa AA seqDB search
MSYINLPTVLPISPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSNSFSTHDRNTMDALPACMLKDVAQEALGVAVIGIDEGQFFPDIVDFCETMANTGKTVI
VAALDGTFQRKAFGSILNLVPLAESVVKLTAVCMECFREASYTKRLGLEKEVEVIGGADK
YHSVCRLCYFKKSSAQTADNKENYSVLGQPIEIPAVRKLFAPQQILQCNSAN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagctacatcaacctgcccaccgtgctgcccatctcccccagcaagacccgggggcag
atccaggtgattctcgggcccatgttctcagggaaaagcacggagctgatgaggagagta
aggcgcttccagatcgcccagtacaagtgcctggtcatcaagtatgccaaagacacgcgc
tatagcaacagcttctccacacatgaccggaacaccatggatgcactgccggcctgcatg
ctcaaggatgtggcccaggaggccttgggtgtggctgtcattggcatcgatgaagggcag
tttttccctgacattgtggatttctgtgaaacgatggccaatacaggcaagacagtgatt
gtggcggcgctggacggaaccttccagaggaaggctttcggcagcatcttgaacctggtg
cccttggccgagagtgtggtgaagctcaccgctgtgtgcatggagtgctttcgagaagct
tcctacaccaagaggctgggcctggagaaagaggtggaggtgattggcggagcggacaag
taccactctgtttgccgcctgtgctactttaagaagtcttcagcccagactgcagacaac
aaagagaactactcagtgctggggcagcctatagagatcccggctgtcaggaagctcttt
gcccctcagcaaatcctacagtgtaactctgccaactga

DBGET integrated database retrieval system