KEGG   Rattus norvegicus (rat): 24842
Entry
24842             CDS       T01003                                 

Gene name
Tp53, Trp53, p53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04071  Sphingolipid signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04137  Mitophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04216  Ferroptosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04722  Neurotrophin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24842 (Tp53)
   04310 Wnt signaling pathway
    24842 (Tp53)
   04071 Sphingolipid signaling pathway
    24842 (Tp53)
   04151 PI3K-Akt signaling pathway
    24842 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    24842 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    24842 (Tp53)
   04210 Apoptosis
    24842 (Tp53)
   04216 Ferroptosis
    24842 (Tp53)
   04115 p53 signaling pathway
    24842 (Tp53)
   04218 Cellular senescence
    24842 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    24842 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24842 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    24842 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24842 (Tp53)
   05202 Transcriptional misregulation in cancer
    24842 (Tp53)
   05206 MicroRNAs in cancer
    24842 (Tp53)
   05205 Proteoglycans in cancer
    24842 (Tp53)
   05203 Viral carcinogenesis
    24842 (Tp53)
   05230 Central carbon metabolism in cancer
    24842 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24842 (Tp53)
   05212 Pancreatic cancer
    24842 (Tp53)
   05225 Hepatocellular carcinoma
    24842 (Tp53)
   05226 Gastric cancer
    24842 (Tp53)
   05214 Glioma
    24842 (Tp53)
   05216 Thyroid cancer
    24842 (Tp53)
   05220 Chronic myeloid leukemia
    24842 (Tp53)
   05217 Basal cell carcinoma
    24842 (Tp53)
   05218 Melanoma
    24842 (Tp53)
   05219 Bladder cancer
    24842 (Tp53)
   05215 Prostate cancer
    24842 (Tp53)
   05213 Endometrial cancer
    24842 (Tp53)
   05224 Breast cancer
    24842 (Tp53)
   05222 Small cell lung cancer
    24842 (Tp53)
   05223 Non-small cell lung cancer
    24842 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24842 (Tp53)
   05014 Amyotrophic lateral sclerosis
    24842 (Tp53)
   05016 Huntington disease
    24842 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24842 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24842 (Tp53)
   05161 Hepatitis B
    24842 (Tp53)
   05160 Hepatitis C
    24842 (Tp53)
   05162 Measles
    24842 (Tp53)
   05168 Herpes simplex virus 1 infection
    24842 (Tp53)
   05163 Human cytomegalovirus infection
    24842 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24842 (Tp53)
   05169 Epstein-Barr virus infection
    24842 (Tp53)
   05165 Human papillomavirus infection
    24842 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24842 (Tp53)
   01522 Endocrine resistance
    24842 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24842 (Tp53)
   03036 Chromosome and associated proteins [BR:rno03036]
    24842 (Tp53)
   03400 DNA repair and recombination proteins [BR:rno03400]
    24842 (Tp53)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    24842 (Tp53)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     24842 (Tp53)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    24842 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 24842
NCBI-ProteinID: NP_112251
RGD: 3889
Ensembl: ENSRNOG00000010756
UniProt: P10361
LinkDB
Position
10q24
AA seq 391 aa
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPE
EALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSV
MCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERC
SDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPG
SAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDS
RAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaggattcacagtcggatatgagcatcgagctccctctgagtcaggagacattttca
tgcttatggaaacttcttcctccagatgatattctgcccaccacagcgacagggtcacct
aattccatggaagatctgttcctgccccaggatgttgcagagttgttagaaggcccagag
gaagccctccaagtgtcagctcctgcagcacaggaacctggaactgaggcccctgcaccc
gtggcccctgcttcagctacaccgtggcctctgtcatcttccgtcccttctcaaaaaact
taccaaggcaactatggcttccacctgggcttcctgcagtcagggacagccaagtctgtt
atgtgcacgtactcaatttccctcaataagctgttctgccagctggcgaagacatgccct
gtgcagttgtgggtcacctccacacctccacctggtacccgtgtccgtgccatggccatc
tacaagaagtcacaacacatgactgaggtcgtgagacgctgcccccaccatgagcgttgc
tctgatggtgacggcctggctcctccccaacatcttatccgggtggaaggaaatccgtat
gctgagtatctggacgacaggcagacttttcggcacagcgtggtggtaccgtatgagcca
cctgaggtcggctccgactataccactatccactacaagtacatgtgcaacagctcctgc
atggggggcatgaaccgccggcccatccttaccatcatcacgctggaagactccagtggg
aatcttctgggacgggacagctttgaggttcgtgtttgtgcctgtcctgggagagaccgt
cggacagaggaagaaaatttccgcaaaaaagaagagcattgcccggagctgcccccaggg
agtgcaaagagagcactgcccaccagcacaagctcctctccccagcaaaagaaaaaacca
ctcgatggagaatatttcacccttaagatccgtgggcgtgagcgcttcgagatgttccga
gagctgaatgaggccttggaattaaaggatgcccgtgctgccgaggagtcaggagacagc
agggctcactccagctacccgaagaccaagaagggccagtctacgtcccgccataaaaaa
ccaatgatcaagaaagtggggcctgactcagactga

DBGET integrated database retrieval system