KEGG   Rattus norvegicus (rat): 24849
Entry
24849             CDS       T01003                                 

Gene name
Tpi1
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24849 (Tpi1)
   00051 Fructose and mannose metabolism
    24849 (Tpi1)
   00562 Inositol phosphate metabolism
    24849 (Tpi1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24849 (Tpi1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     24849 (Tpi1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24849 (Tpi1)
  Exosomal proteins of bladder cancer cells
   24849 (Tpi1)
  Exosomal proteins of melanoma cells
   24849 (Tpi1)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-GeneID: 24849
NCBI-ProteinID: NP_075211
RGD: 3896
Ensembl: ENSRNOG00000015290
UniProt: P48500
LinkDB
Position
4
AA seq 249 aa
MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWCKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEGVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaggaagaaa
tgcctgggagaactcatctgcactctgaacgcagccaagctgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgactttgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggccttcactggggaaatcagt
cctggcatgatcaaggacttaggagctacctgggtggtgctgggacactctgaaagaaga
cacatctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gagaaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtgcaag
gtggtcctggcctatgaaccagtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaaatgcaacgtctctgagggg
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcgtggacattatcaatgccaaacaatga

KEGG   Rattus norvegicus (rat): 500959
Entry
500959            CDS       T01003                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    500959
   00051 Fructose and mannose metabolism
    500959
   00562 Inositol phosphate metabolism
    500959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    500959
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     500959
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   500959
  Exosomal proteins of bladder cancer cells
   500959
  Exosomal proteins of melanoma cells
   500959
SSDB
Motif
Pfam: TIM GCM
Other DBs
NCBI-GeneID: 500959
NCBI-ProteinID: NP_001028244
RGD: 1560534
UniProt: Q6SA19
LinkDB
Position
8
AA seq 249 aa
MAPSRKFFVGGNWKMNGKKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITDKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEEVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaagaagaaa
tgcctgggagaactcatctgcaccctgaacgcagccaagatgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgacttcgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggctttcactggggaaatcagc
cctggcatgatcaaagacttaggagctacctgggtggtgctgggacactcggaaagaaga
cacgtctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gataaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtccaag
gtggtcctggcctatgaaccggtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaagtgcaacgtctctgaggag
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcgtggacattatcaatgccaaacaatga

DBGET integrated database retrieval system